| Sequence 1: | NP_651055.1 | Gene: | tHMG1 / 42650 | FlyBaseID: | FBgn0038978 | Length: | 126 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001121162.1 | Gene: | Ubtf / 25574 | RGDID: | 3927 | Length: | 764 | Species: | Rattus norvegicus |
| Alignment Length: | 69 | Identity: | 18/69 - (26%) |
|---|---|---|---|
| Similarity: | 35/69 - (50%) | Gaps: | 1/69 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
Fly 73 LKQW 76 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tHMG1 | NP_651055.1 | HMG_box | 8..76 | CDD:459837 | 18/67 (27%) |
| Ubtf | NP_001121162.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
| HMG-box_UBF1_rpt1-like | 109..185 | CDD:438814 | |||
| HMG-box_UBF1_rpt2 | 196..270 | CDD:438815 | 18/69 (26%) | ||
| HMG-box_UBF1_rpt3 | 297..379 | CDD:438816 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 370..411 | ||||
| HMG-box_UBF1_rpt4 | 405..470 | CDD:438817 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 456..488 | ||||
| HMG_box_5 | 479..562 | CDD:434287 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 546..576 | ||||
| HMG-box_UBF1_rpt6-like | 565..650 | CDD:438819 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 648..764 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||