DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Sox8

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_035577.1 Gene:Sox8 / 20681 MGIID:98370 Length:464 Species:Mus musculus


Alignment Length:82 Identity:23/82 - (28%)
Similarity:44/82 - (53%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARP--KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAE 68
            |:|  |:||:|||:|..:..|| :..::|.....|:|...|::||.:::.:|..:.|.|.....:
Mouse    95 AKPHVKRPMNAFMVWAQAARRK-LADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQ 158

  Fly    69 YKEKLKQWNFPKEHRFS 85
            :|:....:.:....|.|
Mouse   159 HKKDHPDYKYQPRRRKS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/69 (29%)
Sox8NP_035577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Sox_N 18..86 CDD:463586
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P57073 55..97 1/1 (100%)
HMG-box_SoxE 98..172 CDD:438840 19/74 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..244 3/22 (14%)
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P57073 221..299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..315
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P57073 347..464
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..374
9aaTAD. /evidence=ECO:0000250|UniProtKB:P57073 418..426
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..464
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.