DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Sox7

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_035576.1 Gene:Sox7 / 20680 MGIID:98369 Length:380 Species:Mus musculus


Alignment Length:85 Identity:20/85 - (23%)
Similarity:41/85 - (48%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            :|.::||:|||:|.... ||.:..::||....|:|...|:.|:|:....|..:.:.|.....::.
Mouse    43 SRIRRPMNAFMVWAKDE-RKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHM 106

  Fly    71 EKLKQWNF-PKEHRFSDTQC 89
            :....:.: |:..:.....|
Mouse   107 QDYPNYKYRPRRKKQGKRLC 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 17/67 (25%)
Sox7NP_035576.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43 20/85 (24%)
HMG-box_SoxF_SOX7 34..121 CDD:438849 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167
Sox17_18_mid 175..219 CDD:463454
Required for beta-catenin-binding 323..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.