DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Sox15

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:91 Identity:24/91 - (26%)
Similarity:48/91 - (52%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73
            |:||:|||:| :|..|:.:..::|.....|:|.:.|..|:.:.||:|..:.|.|....|.:..  
Mouse    48 KRPMNAFMVW-SSVQRRQMAQQNPKMHNSEISKRLGAQWKLLGDEEKRPFVEEAKRLRARHLR-- 109

  Fly    74 KQWNFPKEHRFSDTQCICSSNTNQCP 99
               ::| ::::...:...:|:|...|
Mouse   110 ---DYP-DYKYRPRRKSKNSSTGSVP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/66 (30%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45
HMG-box_SoxA_SoxB_SoxG 46..121 CDD:438837 21/79 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 4/22 (18%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.