DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmg-5

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_501245.1 Gene:hmg-5 / 177543 WormBaseID:WBGene00001975 Length:204 Species:Caenorhabditis elegans


Alignment Length:70 Identity:17/70 - (24%)
Similarity:27/70 - (38%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKE 71
            ||..|.||:.|::..      |........:|...:....|:|..|..|..:.:.|.....||..
 Worm   131 RPSVPPSAYALFIKE------KLSGAGMESKEKMKEAVAQWKAFTDSQKKKYTDEAKKLKDEYHV 189

  Fly    72 KLKQW 76
            .|::|
 Worm   190 VLQKW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 15/67 (22%)
hmg-5NP_501245.1 HMG-box_SF 35..81 CDD:438789
HMG-box_SF 132..197 CDD:469606 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.