DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and sem-2

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_740846.1 Gene:sem-2 / 172162 WormBaseID:WBGene00004771 Length:404 Species:Caenorhabditis elegans


Alignment Length:79 Identity:28/79 - (35%)
Similarity:40/79 - (50%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESA----TTAMAEY 69
            |:||:|||:|.....|| |....||....|:|.:.|..||::.||:|..:...|    ...|.||
 Worm    94 KRPMNAFMVWSQMERRK-ICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCHMQEY 157

  Fly    70 KE-KLKQWNFPKEH 82
            .: |.|....||::
 Worm   158 PDYKYKPRKKPKKN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 26/71 (37%)
sem-2NP_740846.1 HMG-box_SoxC 92..159 CDD:438838 24/65 (37%)

Return to query results.
Submit another query.