DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and sox6

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_031755685.1 Gene:sox6 / 100144640 XenbaseID:XB-GENE-483934 Length:804 Species:Xenopus tropicalis


Alignment Length:83 Identity:25/83 - (30%)
Similarity:41/83 - (49%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73
            |:||:|||:|.....||.::| .||.....:|...|..|:||::::|..:.|........:.||.
 Frog   598 KRPMNAFMVWAKDERRKILQA-FPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKY 661

  Fly    74 KQWNF-PKEHRFSDTQCI 90
            ..:.: |:..|    .||
 Frog   662 PNYKYKPRPKR----TCI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 21/66 (32%)
sox6XP_031755685.1 HMG-box_EGL13-like 595..672 CDD:438848 22/74 (30%)

Return to query results.
Submit another query.