DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and BBS10

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_078961.3 Gene:BBS10 HGNCID:26291 Length:723 Species:Homo sapiens

Alignment Length:471 Identity:84/472 (18%)
Similarity:170/472 (36%) Gaps:112/472 (24%)


  Fly     4 LASPLSIAGTRQSGASVRTQNVMAALSISN----IVKSSLGPVGLDKMLVDDIGDVTVTNDGATI 64
            :.|.::.||           :|.|||.::.    ||...:||.|...:.....|:|.::.:|..:
Human     1 MLSSMAAAG-----------SVKAALQVAEVLEAIVSCCVGPEGRQVLCTKPTGEVLLSRNGGRL 54

  Fly    65 LRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHP------------ 117
            |..|.:|||.|:::|:......::.|||..:.:|....||:....:..::..|            
Human    55 LEALHLEHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDPLMCENIQTHGRH 119

  Fly   118 ------------------TSIISGYRIACKEACKYISEHL-----TAPVDELGRDSLINIAKTSM 159
                              |.|:.|.      ..:|:|.|.     :|....|.|.||..:.:...
Human   120 WKNCSRWKFISQALLTFQTQILDGI------MDQYLSRHFLSIFSSAKERTLCRSSLELLLEAYF 178

  Fly   160 SSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIA 224
            ..::...:.:|.|.::.|               |..|.:......|...    |:..:.:...:.
Human   179 CGRVGRNNHKFISQLMCD---------------YFFKCMTCKSGIGVFE----LVDDHFVELNVG 224

  Fly   225 SQQMP---KKIVNAKIACLDFSLQKT---KMKM--------------GVQVLINDPDKLEAIRAR 269
            ...:|   .:|:...:...|||:.:.   .|:|              |.:.::|...:.:..:..
Human   225 VTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQPLFSTSGSEFILNSEAQFQTSQFW 289

  Fly   270 ELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSL 334
            .::.||..:..:....|.:::.|....||...|....|...|..:...::.:|.:..|      |
Human   290 IMEKTKAIMKHLHSQNVKLLISSVKQPDLVSYYAGVNGISVVECLSSEEVSLIRRIIG------L 348

  Fly   335 TNMDGEESFDASMVGEAAEVAQERICDDELILIK--------GTKARAAASIILRGPNDFYCDEM 391
            :.....::|....:...|.|   :.|...::..|        .|.|....||:|.||.....::.
Human   349 SPFVPPQAFSQCEIPNTALV---KFCKPLILRSKRYVHLGLISTCAFIPHSIVLCGPVHGLIEQH 410

  Fly   392 ERSVHDALCVVKRVLE 407
            |.::|.||.:::::.:
Human   411 EDALHGALKMLRQLFK 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 83/468 (18%)
TCP1_alpha 12..538 CDD:239451 82/464 (18%)
BBS10NP_078961.3 chaperonin_like 11..>426 CDD:295468 81/449 (18%)
chaperonin_like <597..644 CDD:295468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.