DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and CCT3

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001189236.1 Gene:CCT3 FlyBaseID:FBgn0015019 Length:544 Species:Drosophila melanogaster

Alignment Length:535 Identity:174/536 (32%)
Similarity:287/536 (54%) Gaps:43/536 (8%)


  Fly    14 RQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVL 78
            |:||..|:.:|:.|..:|::::::.|||..:.|||:|.:|.:.:||||..|||.:.|:|||||.:
  Fly    17 RESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSM 81

  Fly    79 VELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPV 143
            :|:|:.||||||||||||::||.|:|..|:..::|:||||.||..||.|.::...::...|:..:
  Fly    82 IEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQL 146

  Fly   144 DELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKA-INVLKAHGKS 207
            |...:..:.::.|..:.:|.||..::....:.:||.::|.::: .|:....||. ..|.|..|.:
  Fly   147 DVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSE-NGRLEVDIKRYAKVEKIPGGA 210

  Fly   208 ARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQV-LINDPDKLEAIRAREL 271
            ..||.::.|..:|..:...:|.:.|.|.:|..||.||:..|.:....| :|.:.|     ..|.|
  Fly   211 IEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQD-----FTRML 270

  Fly   272 DITKERINM----ILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFIT 332
            .|.:|.:..    |:....::|....||.||...|.::||..|:||::|:|...||:|.||..:.
  Fly   271 QIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVN 335

  Fly   333 ---SLTNMDGEESFDASMVGEAAEVAQ-ERICDDELILIKGTKARAAASIILRGPNDFYCDEMER 393
               .||..|         ||..|.:.: ::|.|:....:...|...|.:|:|||.:....:|.||
  Fly   336 RTEELTEKD---------VGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETER 391

  Fly   394 SVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQL--AIAEFAKSLLVIPKTLS 456
            ::.|||.|.:.::...::|||||.||.|        |:.|.:|:|:  .....|.:|.:||:||:
  Fly   392 NLQDALHVARNLVLEPRLVAGGGAVEMA--------ASQLLTRKQVKGPYTAVAHALEIIPRTLA 448

  Fly   457 VNAAKDATDLVAKLRSYHNSSQTKPERSD--LKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKF 519
            .|...:....:..||:.|.|     ...|  ..| |:|...|.:.|.....:.||...|:::.|.
  Fly   449 QNCGANTIRALTALRAKHAS-----HTGDGVCAW-GIDGESGEIVDMNVKNIWEPLAVKLQTYKT 507

  Fly   520 ATEAAITILRIDDMI 534
            |.|.||.:|||||::
  Fly   508 AVETAILLLRIDDIV 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 174/536 (32%)
TCP1_alpha 12..538 CDD:239451 174/536 (32%)
CCT3NP_001189236.1 chap_CCT_gamma 7..528 CDD:274085 174/536 (32%)
TCP1_gamma 7..524 CDD:239453 174/536 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70152056
eggNOG 1 0.900 E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11353
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.