DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and cct7

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001032347.1 Gene:cct7 XenbaseID:XB-GENE-988120 Length:542 Species:Xenopus tropicalis

Alignment Length:549 Identity:193/550 (35%)
Similarity:299/550 (54%) Gaps:34/550 (6%)


  Fly    12 GTRQS-GASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAA 75
            ||..| |......|:.|...|:..|:::|||.|:||::|||.|..|::|||||||:||:|.||||
 Frog    12 GTDTSQGVPQLVSNINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAA 76

  Fly    76 KVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISE-HL 139
            |.||::|:.||.|||||||||.:||||.:|.....|::.:||..||..||.|.:.|...|.| .:
 Frog    77 KTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIREIAV 141

  Fly   140 TAPVDELGRDSLI--NIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLK 202
            |...::.....|:  ..|.|::|||:|....:||:.|||||   |.:.|...|    :|.|.:.|
 Frog   142 TVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDA---VSLLDDLLQ----LKMIGIKK 199

  Fly   203 AHGKSARESVLIPGYALNCTIA---SQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLE 264
            ..|.:..:|.|:.|.|...|.:   .:..|||..:.||:.|:..|:....|...:|.:::.:..:
 Frog   200 VQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELELKAEKDNAEVRVSNIEDYQ 264

  Fly   265 AIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAA 329
            ||...|.:|..:::..|..:|..|||....:.|:..:||.:.......||.:.|||....|.|.:
 Frog   265 AIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGS 329

  Fly   330 FITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERS 394
            ..||:..:..:      ::|..|...:.::..:......|.......:|||||..:.:.:|.|||
 Frog   330 IQTSVNALTDD------VLGHCALFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERS 388

  Fly   395 VHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNA 459
            :|||:.:|:|.:::..||||||.:|..||.||.:::.::..::||.|..:||:|.:||:.|..||
 Frog   389 LHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNA 453

  Fly   460 AKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAA 524
            ..|||:::.|||:.|....        .|.|:|:....:.||..|.|.|||:.:|.:|..|:|||
 Frog   454 GFDATNILNKLRAKHAQGG--------MWYGVDVNNEDIADNFDACVWEPAIVRINALTAASEAA 510

  Fly   525 ITILRIDDMIKLNPEDKSGKSYADACAAG 553
            ..:|.:|:.|| ||     :|..|...||
 Frog   511 CLVLSVDETIK-NP-----RSSMDGAPAG 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 189/538 (35%)
TCP1_alpha 12..538 CDD:239451 188/533 (35%)
cct7NP_001032347.1 TCP1_eta 5..525 CDD:239456 189/540 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.