DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and CCT4

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_609579.1 Gene:CCT4 FlyBaseID:FBgn0032444 Length:533 Species:Drosophila melanogaster

Alignment Length:546 Identity:170/547 (31%)
Similarity:288/547 (53%) Gaps:29/547 (5%)


  Fly     1 MSTLASPLSIAGT------RQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTN 59
            |:..|:.::|..|      :.....||..|:.||.::|:.:::||||.|:|||:....|:|::||
  Fly     1 MAPKAAAVNIKPTAKAFKDKSKPTDVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITN 65

  Fly    60 DGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGY 124
            ||||||:.:.|.|||||:||||::.||...||||||||::|..||:..::|:::.:|||:|...:
  Fly    66 DGATILKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSF 130

  Fly   125 RIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRG 189
            : .|......|.:.::.|::...|::||..|.||::||::...:...:.:.|||.  :|:|||..
  Fly   131 Q-RCSNKAVEILKQMSTPIELDDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAV--LKVTDPGK 192

  Fly   190 QAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQ 254
            :.:..:|.|.|:.:.|.:..::.|:.|....|..|....||:|..|||..:.|.:...|..|...
  Fly   193 ETSVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHN 257

  Fly   255 VLINDPDKLEAIRARELDITKERINMILGTGVNVVLVS-----GGVDDLCMKYFVEAGAMAVRRV 314
            |:::|...::.:...|.......:..|..:|.||:||.     ..|.||...:..:...|.|:.|
  Fly   258 VIVSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDV 322

  Fly   315 KKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARA-AASI 378
            ::.|::.:.|......|.||.:...|....|.:|.|.|...      ::.:.|.|.:... ..||
  Fly   323 EREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGT------NKFVKITGIQNMGRTVSI 381

  Fly   379 ILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAE 443
            |.||.|....:|..||:|||||||:.:::.:..:.|||..|..:::.|...|.::...:......
  Fly   382 ICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAYCFRA 446

  Fly   444 FAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLE 508
            ||.:|.|||.||:.||..:....|.:||:.|...:        |..|:::.:|.:.|.....|::
  Fly   447 FADALEVIPSTLAENAGLNPIATVTELRNRHAQGE--------KNAGINVRKGAITDIFAENVVQ 503

  Fly   509 PAMSKIKSLKFATEAAITILRIDDMI 534
            |.:..|.|:..|||...:||:|||::
  Fly   504 PLLVSISSITLATETIRSILKIDDIV 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 168/540 (31%)
TCP1_alpha 12..538 CDD:239451 167/536 (31%)
CCT4NP_609579.1 TCP1_delta 18..531 CDD:239454 166/530 (31%)
Cpn60_TCP1 37..529 CDD:278544 161/509 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70182048
eggNOG 1 0.900 E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11353
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.