DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and CCT6

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_573066.1 Gene:CCT6 FlyBaseID:FBgn0027329 Length:533 Species:Drosophila melanogaster

Alignment Length:521 Identity:135/522 (26%)
Similarity:262/522 (50%) Gaps:27/522 (5%)


  Fly    24 NVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEE 88
            |:.||..:.::::::|||.|..||||...||:.:|.||..:|..::::||.|.::...:..||:.
  Fly    23 NISAAKGLQDVMRTNLGPKGTVKMLVSGAGDIKITKDGNVLLHEMQIQHPTASMIARASTAQDDS 87

  Fly    89 VGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLIN 153
            .|||||:.|:|..||||.||..:.:.:||..:..|:..|..:|.: :.:.:..|| |:.:.:|:.
  Fly    88 TGDGTTTTVMLIGELLKQADIYLSEGLHPRIMTDGFEKARDKALE-VLDQVKVPV-EINKKNLVE 150

  Fly   154 IAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYA 218
            :|.||:.:|:..|.|:..:.:.|:|..::...|.  .....:..:.:::...||..::.|:.|..
  Fly   151 VANTSLKTKVHPALADLLTDVCVNAVLTIASADK--TKPVDLHMVELMEMQHKSDTDTQLVRGLV 213

  Fly   219 LNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMIL- 282
            ::.......|||::.||.|...:.||:..|.::.........::.||....|.:...:|:..:: 
  Fly   214 MDHGARHPDMPKRLENAYILTANVSLEYEKAEVNSGFFYKTAEEREAFVRAEREFIDQRVKKVIE 278

  Fly   283 -------GTGVNVVLVS-GGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDG 339
                   ||....||:: .|:|.:.:....:.|.:|:||.|:.:::.::.|.|...:.|..::..
  Fly   279 LKRSVCDGTDKTFVLINQKGIDPISLDALAKEGILALRRAKRRNMERLSLACGGTAMNSFDDLQE 343

  Fly   340 EESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKR 404
            |.      :|.|..|.:..:.:::...::..|...:.:|:::|||.....:::.::.|.|..:..
  Fly   344 EH------LGYAGVVYEHVLGENKYTFVEDCKNPLSVTILIKGPNKHTITQIKDAIRDGLRAINN 402

  Fly   405 VLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAK 469
            .:..|.:|.|.|..|......|..|..::..:.:||:..||.:||||||||:||:..||.|.:.|
  Fly   403 TIADKALVPGAGAFEVRAYNELVAFKDTIKGKSRLAVQAFADALLVIPKTLAVNSGYDAQDTIVK 467

  Fly   470 LRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMI 534
            |        |..:|...:..||||..|........||.:..:.|.:.|...:..|..:|.:|:::
  Fly   468 L--------TVEDRLSPELVGLDLATGEPMKPVDLGVYDNYIVKKQILNSCSIIASNLLLVDEVM 524

  Fly   535 K 535
            :
  Fly   525 R 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 135/522 (26%)
TCP1_alpha 12..538 CDD:239451 135/522 (26%)
CCT6NP_573066.1 chap_CCT_zeta 3..532 CDD:274088 135/522 (26%)
TCP1_zeta 7..528 CDD:239458 135/522 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69281359
eggNOG 1 0.900 E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11353
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.