DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and CCT2

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster

Alignment Length:531 Identity:185/532 (35%)
Similarity:302/532 (57%) Gaps:42/532 (8%)


  Fly    21 RTQNVMAALSISNIVKSSLGPVGLDKMLV---DDIGDVTVTNDGATILRLLEVEHPAAKVLVELA 82
            |..:.:.|::|.::|||:|||.|:||:||   .:.|.|.||||||||||.:.|::||||:||:::
  Fly    24 RLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILVDMS 88

  Fly    83 QLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPV---- 143
            ::||||||||||||.:||:|||:.|::||:||:||..|:||:|    :|.:...|.|||..    
  Fly    89 RVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWR----QATQVALEALTAAAQDNS 149

  Fly   144 --DELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGK 206
              ||..|:.|:|||:|::||||:....:||:.:.|||...:|       .:..:|:|.::|..|.
  Fly   150 SSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLK-------GSGELKSIQIIKKSGG 207

  Fly   207 SARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKM-GVQVLINDPDKLEAIRARE 270
            :..:|.|..|:.|:......| |::|.||:|...:..:...|:|: |..:.::...|:..:...|
  Fly   208 TLGDSFLDEGFLLDKKPGVHQ-PQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAE 271

  Fly   271 LDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLT 335
            .:..||:::.||....||.:....:.:...:.|.:|..|::.......::.:|..||...:::..
  Fly   272 KEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIVSTFE 336

  Fly   336 NMDGEESFDASMV--GEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSVHDA 398
            |        .|:|  ||...:.|..|.:|.|:...|.|...|.:|::||......||.:||:|||
  Fly   337 N--------PSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHDA 393

  Fly   399 LCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDA 463
            |||:...::..:::.||||.||.::..:...|.....:|.:||..||::||.:|..::.||..|:
  Fly   394 LCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYDS 458

  Fly   464 TDLVAKLRSYH-NSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITI 527
            ..||::||:.| ...||         .|||:..|.|.|.::.|:.|....|.:.|..|:|||..|
  Fly   459 AQLVSELRAGHAQGKQT---------LGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMI 514

  Fly   528 LRIDDMIKLNP 538
            ||:|::|:..|
  Fly   515 LRVDNIIRCAP 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 185/532 (35%)
TCP1_alpha 12..538 CDD:239451 184/530 (35%)
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 185/532 (35%)
TCP1_beta 10..527 CDD:239452 185/532 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69619397
eggNOG 1 0.900 E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11353
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.