DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and Mkks

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001008354.1 Gene:Mkks RGDID:1308814 Length:570 Species:Rattus norvegicus

Alignment Length:586 Identity:125/587 (21%)
Similarity:235/587 (40%) Gaps:99/587 (17%)


  Fly    22 TQNVMAALSI-SNIVKSSLGPVGLDKMLVDDIGD-VTVTNDGATILRLLEVEHPAAKVLVELAQL 84
            ::.|.:.||: ..|:.|..||.|..|.|.:.:|. |..|:..:.:||.|.|.||..|||....|.
  Rat    19 SERVRSTLSVLKGIIASCYGPSGRLKQLHNGLGGCVCTTSQSSALLRNLSVTHPILKVLTSSVQN 83

  Fly    85 QDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIIS------GYRIAC--KEACKYISEHLTA 141
            ......|......||...|::|...:   .:.||:.|.      |..|:.  .|||.     ...
  Rat    84 HVCCFSDCGLFTAILCCNLIENIQRI---GLTPTTAIKLNKYLLGLSISYLKSEACS-----CRI 140

  Fly   142 PVDELGRDSLINIAKTSMSSK----IIGADAEFFSAMVVDAAQSVKITDPRGQAAYSI--KAINV 200
            |||.....:.:|:..:.::||    :...:.:...|:::.|   ..:|.|.......:  |:| :
  Rat   141 PVDFRSTHTFLNLVHSILTSKPACMLTRKEIDHIGALILKA---FLLTIPESAEERMVLGKSI-I 201

  Fly   201 LKAHGKSARESVLIPGYALNCTIASQQMPKKI--------VNAKIACLDFSLQKTKMKMGVQVLI 257
            :...|:...:|.::||..:.   ||:...:::        :...:.|...|...:....|..|:.
  Rat   202 VPLKGQQVTDSTVLPGLLIE---ASEVQLRRLLPTQKSSTLRVALFCASLSGDFSNAGEGTLVVH 263

  Fly   258 NDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKII 322
            .......|:..:.|::.::    ::...|::||....:.....::..|...:|:.||..:.::.:
  Rat   264 YQVSLENAVLEQLLNLGRQ----LVSDHVDLVLCQKVIHPSLKQFLSEHQIIAIDRVGVTLMEPL 324

  Fly   323 AKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFY 387
            :|.|||..|.||      ....::..|...:|...|........:...:| ...|::|...||..
  Rat   325 SKVTGATPIGSL------YPIVSTTYGSVKDVRSARFGSKYFFHLLPNEA-TICSLLLCSRNDTA 382

  Fly   388 CDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYL----ENFATSL-----ASREQLAIA- 442
            .:|::.:...|:.|::..::...|:.||||||..|:.|:    .|.|.::     .|:.:|.|| 
  Rat   383 WEELKLTCQTAMHVLQLTIKEPWVLLGGGCVETHLAAYIRHKVHNEAEAIVRDDGCSQAELHIAT 447

  Fly   443 -EFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKW--------TGL-----DL 493
             .|..:|    ::.:|:...|..:::..::..|..|......|...|        .||     :|
  Rat   448 EAFCSAL----ESAAVSLEHDGGEILIDMKYGHFWSCPADSASVGNWPDTLSRCGCGLYNSQEEL 508

  Fly   494 IEGVVRD------------NKKAG-----VLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDK 541
            ...|:|.            ...:|     .::...:|:..|:.|.|.|..||.:..:|    |||
  Rat   509 SWSVLRSTYHPFAPQTCLPQAASGSVSNLTVDSFTAKLSGLQVAVETANLILDLSYVI----EDK 569

  Fly   542 S 542
            :
  Rat   570 N 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 125/587 (21%)
TCP1_alpha 12..538 CDD:239451 122/581 (21%)
MkksNP_001008354.1 Cpn60_TCP1 29..569 CDD:278544 121/574 (21%)
chaperonin_like 32..456 CDD:295468 99/454 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.