DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and cct1

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_595949.1 Gene:cct1 PomBaseID:SPBC12D12.03 Length:556 Species:Schizosaccharomyces pombe

Alignment Length:538 Identity:358/539 (66%)
Similarity:441/539 (82%) Gaps:4/539 (1%)


  Fly     6 SPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEV 70
            |.|.::|.:.||..||.|||:|..:|:|:|||||||||||||||||||||||||||||||.||:|
pombe     8 STLFLSGEKISGEDVRNQNVLATTAIANVVKSSLGPVGLDKMLVDDIGDVTVTNDGATILSLLDV 72

  Fly    71 EHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYI 135
            ||||.||||||||.||:|||||||||||:|||||:.|:||||.|||||:||:|||:|.:||.|::
pombe    73 EHPAGKVLVELAQQQDKEVGDGTTSVVIIAAELLRRANELVKNKIHPTTIITGYRLAIREAVKFM 137

  Fly   136 SEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINV 200
            ::.|:..||.||::||||:|||||||||||.|::|||.|.|||..|||.::.:|:..|.:||:|:
pombe   138 TDVLSCSVDSLGKESLINVAKTSMSSKIIGNDSDFFSTMAVDAMLSVKTSNSKGETRYPVKAVNI 202

  Fly   201 LKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEA 265
            |||||||:|||||:.|||||||||||.|..::.|||||.||..||||||.:||.|.|:|||:||.
pombe   203 LKAHGKSSRESVLVKGYALNCTIASQAMKTRVQNAKIAVLDMDLQKTKMALGVHVTIDDPDQLEK 267

  Fly   266 IRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAF 330
            ||.||:.||.||:..||..|.||:|.:.|:||||:|..:|||||||||.||.||:.||||:||..
pombe   268 IREREVMITLERVKKILNAGANVILTTKGIDDLCLKSIIEAGAMAVRRCKKEDLRRIAKASGATL 332

  Fly   331 ITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSV 395
            ::||:|::|||:|::|.:|.|.||.||:..|||.||:|||||.::|||:|||||::..||||||:
pombe   333 LSSLSNLEGEETFESSYLGSAEEVVQEKFSDDECILVKGTKAYSSASIVLRGPNEYSLDEMERSM 397

  Fly   396 HDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAA 460
            ||:|.||||.|||.|||.|||.||.|||||||||||||.|||||||||||::||:||:||:||||
pombe   398 HDSLSVVKRTLESGKVVPGGGAVETALSIYLENFATSLGSREQLAIAEFAQALLIIPRTLAVNAA 462

  Fly   461 KDATDLVAKLRSYHNSSQ----TKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFAT 521
            ||:|:|.||||:||.:||    |..::...|..||||:.||:|||.|||||||:|||:||||.|.
pombe   463 KDSTELTAKLRAYHAASQNAEVTDVKKRGYKNYGLDLLNGVIRDNVKAGVLEPSMSKLKSLKSAV 527

  Fly   522 EAAITILRIDDMIKLNPE 539
            ||.|.|||||..|||:||
pombe   528 EACIAILRIDTSIKLDPE 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 357/537 (66%)
TCP1_alpha 12..538 CDD:239451 354/530 (67%)
cct1NP_595949.1 chap_CCT_alpha 10..549 CDD:274081 357/537 (66%)
TCP1_alpha 14..544 CDD:239451 354/530 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5656
Inparanoid 1 1.050 695 1.000 Inparanoid score I105
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004421
OrthoInspector 1 1.000 T1124419
orthoMCL 1 0.900 OOG5_127998
Panther 1 1.100 LDO PTHR11353
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1484
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.