DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and cct7

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_775355.1 Gene:cct7 ZFINID:ZDB-GENE-020419-7 Length:547 Species:Danio rerio

Alignment Length:561 Identity:196/562 (35%)
Similarity:304/562 (54%) Gaps:35/562 (6%)


  Fly     1 MSTLASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATIL 65
            |||....|........|......|:.|...::..|:::|||.|:||::||:.|..|::|||||||
Zfish     2 MSTPVILLKEGTDTSQGVPQLVSNINACQVVAEAVRTTLGPRGMDKLVVDNRGKATISNDGATIL 66

  Fly    66 RLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKE 130
            :||:|.|||||.||::|:.||.|||||||||.:||||.||.....|::.:||.:||..:|||.:.
Zfish    67 KLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQL 131

  Fly   131 ACKYISE-HLTAPVDEL--GRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAA 192
            |.|.|.| .:|...|:.  .|..|...|.|:::||:|....:|||.|||||...:....|     
Zfish   132 AVKKIKEIAVTIKKDDKQEQRRLLEKCAATALNSKLIAGQKDFFSKMVVDAVMMLDDLLP----- 191

  Fly   193 YSIKAINVLKAHGKSARESVLIPGYALNCTIA---SQQMPKKIVNAKIACLDFSLQKTKMKMGVQ 254
              :|.|.|.|..|.:..||.|:.|.|...|.:   .:..||:.:|.|||.|:..|:....|...:
Zfish   192 --LKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYMNPKIALLNIELELKAEKDNAE 254

  Fly   255 VLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDL 319
            |.:|..:..:||...|.:|..:::..|..:|..|||....:.|:..:||.........||.:.:|
Zfish   255 VRVNSMEDYQAIVDAEWNILYDKLEKIHKSGAKVVLSKLPIGDVATQYFAYRNLFCAARVVEENL 319

  Fly   320 KIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPN 384
            |....|.|.:..||:.::..:      ::|:.....:.::..:.....||.......:|||||..
Zfish   320 KRTMMACGGSIQTSVGSLTDD------VLGQCELFEEVQVGGERYNFFKGCPKAKTCTIILRGGA 378

  Fly   385 DFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLL 449
            :.:.:|.:||:|||:.:|:|.:::..:|||||.:|..||.||.:::.::..::||.|..:||:|.
Zfish   379 EQFMEETDRSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALE 443

  Fly   450 VIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKI 514
            :||:.|..||..|||:::.|||:.|....        .|.|:|:....:.||.:|.|.||::.:|
Zfish   444 IIPRQLCDNAGFDATNILNKLRAKHAQGG--------MWYGVDVNNEDIADNFQACVWEPSIVRI 500

  Fly   515 KSLKFATEAAITILRIDDMIKLNPEDKSGKSYADA--CAAG 553
            .:|..|:|||..||.:|:.|| ||     :|..|.  .|||
Zfish   501 NALTAASEAACLILSVDETIK-NP-----RSSVDGPPAAAG 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 188/541 (35%)
TCP1_alpha 12..538 CDD:239451 186/532 (35%)
cct7NP_775355.1 chap_CCT_eta 4..525 CDD:274086 189/548 (34%)
TCP1_eta 5..525 CDD:239456 188/547 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.