DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and tcp1

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:XP_002933907.1 Gene:tcp1 XenbaseID:XB-GENE-939843 Length:555 Species:Xenopus tropicalis

Alignment Length:554 Identity:408/555 (74%)
Similarity:476/555 (86%) Gaps:1/555 (0%)


  Fly     4 LASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLL 68
            :..||::.|.|.:|.:||:||||||.||:||||||||||||||||||||||||:||||||||:||
 Frog     1 MEGPLAVFGERSTGEAVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLL 65

  Fly    69 EVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACK 133
            ||||||||||.|||.|||.|||||||||||:||||||||||||||||||||:|.|||:|||||.:
 Frog    66 EVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVR 130

  Fly   134 YISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAI 198
            ||:|:||...||||::.|:|.|:|||||||||.|::||||||||||.:||..||:|||.|.|.:|
 Frog   131 YINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINSI 195

  Fly   199 NVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKL 263
            |||||||:|.:||:|:.||||||.:.||.|.|:|||||||||||||||||||:||||:|:||.||
 Frog   196 NVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKL 260

  Fly   264 EAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGA 328
            :.||.||.|||||||..||.||.||:|.:||:||:|:||||:|||||||||.|.|||.|||||||
 Frog   261 DQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGA 325

  Fly   329 AFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMER 393
            ...::|.|::|||||:|||:|:|.||.|||||||||||:|.||||..|||||||.|||.||||||
 Frog   326 IMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMER 390

  Fly   394 SVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVN 458
            ||||||||||||||||.||.|||.|||||||||||:|||:.|||||||||||::||||||||:||
 Frog   391 SVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARALLVIPKTLAVN 455

  Fly   459 AAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEA 523
            ||:|:||||||||::||.:|..|||.:|||.||||:.|..||||:|||.||.:.|.|||||||||
 Frog   456 AAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEA 520

  Fly   524 AITILRIDDMIKLNPEDKSGK-SYADACAAGELD 556
            |||||||||:|||:||.|..| .|.:|..:|.::
 Frog   521 AITILRIDDLIKLHPEAKEEKGKYHEAVQSGSIE 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 403/535 (75%)
TCP1_alpha 12..538 CDD:239451 399/526 (76%)
tcp1XP_002933907.1 chap_CCT_alpha 5..540 CDD:274081 403/535 (75%)
TCP1_alpha 9..535 CDD:239451 399/526 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5656
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 1 1.000 FOG0004421
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.