DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT1 and bbs10

Sequence 1:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:XP_021323237.1 Gene:bbs10 ZFINID:ZDB-GENE-060503-355 Length:567 Species:Danio rerio

Alignment Length:533 Identity:97/534 (18%)
Similarity:179/534 (34%) Gaps:192/534 (36%)


  Fly    31 ISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTS 95
            :.::|:..|||.|...:...|.|:..::..|..:|..|.:|||.|:::::......:..||||.|
Zfish    22 LESVVRRCLGPEGGSVLFTRDTGETLISRHGQRVLSTLHLEHPMARMVLDCVCAHAKSTGDGTKS 86

  Fly    96 VVILAAELLK--------------------------------NADELVKQKIHPTS--------- 119
            .::|.:.||:                                ..|:::..::.|.:         
Zfish    87 FILLLSALLRAIQDSAHMRRKASWSNPALQNLANRLMALSRNELDDIIIHQVTPYASSYCSHHSD 151

  Fly   120 ---------IISGY--------------RIACK------------EACKYISEHLTAPVDELGRD 149
                     :||||              .|.|:            |...:|..|           
Zfish   152 KLEHSILDYLISGYISGRTGAGQAEILKHILCEFYYKSKRDQNTTETISFIHSH----------- 205

  Fly   150 SLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLI 214
              .|:..|.::...:|. :|....:||....|| .|:.||    .|||:.:.::.|.|..:    
Zfish   206 --FNVLHTRVAGLPVGC-SEVIEGLVVTRDWSV-WTELRG----PIKALVLYESFGSSLGD---- 258

  Fly   215 PGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERIN 279
                 |.|:..||             |: |.:|:                       .|||:::.
Zfish   259 -----NITVCFQQ-------------DW-LSRTE-----------------------SITKQKLA 281

  Fly   280 MILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFD 344
            .:|...|||||.|....: |:..:.....:|:.....||.           :..|.|::..|:  
Zfish   282 YLLELQVNVVLSSVKQPE-CVLQWARMNHVALLECVDSDQ-----------LDFLCNINFPET-- 332

  Fly   345 ASMVGEAAEVAQERICDDELILIKGTKARA------AASIILRGPNDFYCDE---MERSVHDALC 400
               :.....:...:.|  :.:.:.|.:...      |.:::|..|.....|:   :.|.|...|.
Zfish   333 ---LSHPQHIVMLKYC--KRLQLGGLRCAQLGIYSNAHTLVLCAPAPGLLDQTVCVSRGVFLMLQ 392

  Fly   401 VVKRVLES---------------------KKVVAGGGC--VEAALSIYLENFATSLASREQLAIA 442
            .:.|.|||                     :.|:..||.  |.......|.:|..:..:.:..:..
Zfish   393 HITRTLESNQFKSSSVDQSQCTVSSQDLWRAVMQAGGVLPVGGVFEFLLHHFLLTRHTSDPESCR 457

  Fly   443 EFAKSLLVIPKTL 455
            ..|::||.:|:.|
Zfish   458 LLAEALLCVPRAL 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 97/534 (18%)
TCP1_alpha 12..538 CDD:239451 97/534 (18%)
bbs10XP_021323237.1 chaperonin_like 22..474 CDD:322083 97/534 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.