DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lqfR and TELO2

Sequence 1:NP_732736.2 Gene:lqfR FlyBaseID:FBgn0261279 Length:1415 Species:Drosophila melanogaster
Sequence 2:XP_011521075.1 Gene:TELO2 HGNCID:29099 Length:899 Species:Homo sapiens

Alignment Length:1009 Identity:230/1010 (23%)
Similarity:374/1010 (37%) Gaps:256/1010 (25%)


  Fly   512 QPPSEAMRLAFSKAQKQLRDLMQVQSAS--------AVAQVAAILGELHNSNALPGFTTPEQLVG 568
            :|....:|||       :|:.:...|:|        .:..:...|||: ...|||          
Human     2 EPAPSEVRLA-------VREAIHALSSSEDGGHIFCTLESLKRYLGEM-EPPALP---------- 48

  Fly   569 LDRQTCDWTCLAHGEYAALLNQLTELFSQDWPEPSQDVEVVNIFKLDHSFDYVSVAFESLQTRLD 633
              |:..::   |...::.:|..|....|..|.|           .|.|.             ||:
Human    49 --REKEEF---ASAHFSPVLRCLASRLSPAWLE-----------LLPHG-------------RLE 84

  Fly   634 KFPSTISSLLENMVKDESLI-----------SIALLHISRQRASLMQRFAR--TIKVMPERKVEE 685
            :.  ..|..||.......|:           |..|:.::|    |:.||.|  .:.|:.|.:..:
Human    85 EL--WASFFLEGPADQAFLVLMETIEGAAGPSFRLMKMAR----LLARFLREGRLAVLMEAQCRQ 143

  Fly   686 LDAQVKAFFQLL--------ISLPAQVANRLGRRLPETFAPVSYQKLLLRQWLKSLHFVLQCDDN 742
               |.:..|.||        ::||..:.|||.:.....|.|.:|.:||..:.::    |||...:
Human   144 ---QTQPGFILLRETLLGKVVALPDHLGNRLQQENLAEFFPQNYFRLLGEEVVR----VLQAVVD 201

  Fly   743 REYFDLEPYSWLLSQAINLIYDVSTLESLLRVLKDYAVAPR----------GRKVVHTILKELDP 797
            .....|:.....:||.:.........:.:|.||     .||          .::|...:::::..
Human   202 SLQGGLDSSVSFVSQVLGKACVHGRQQEILGVL-----VPRLAALTQGSYLHQRVCWRLVEQVPD 261

  Fly   798 AACLKTAQSALSAGLN---LYVLIGAATLETPHWKHCLLQKLPLQRTPVDNKQLITLASYL---N 856
            .|........:.|.|.   |..|:|...::....:..:.|||...::.:....|.:|..:|   :
Human   262 RAMEAVLTGLVEAALGPEVLSRLLGNLVVKNKKAQFVMTQKLLFLQSRLTTPMLQSLLGHLAMDS 326

  Fly   857 AVAPAQLQVLLNQLLGIW--SKRISLQKLGSQEHLAISKLLVLAAKCLCGNLVMDLNIQR----- 914
            ...|..||| |.:||..|  |..|....|..|.|  :||.:::   ||......:|...|     
Human   327 QRRPLLLQV-LKELLETWGSSSAIRHTPLPQQRH--VSKAVLI---CLAQLGEPELRDSRDELLA 385

  Fly   915 QLHDGLSNHLQSPDALQRHVGMKTVELIFNFIALPDAKEDDRLRFEYDSFKDTFHWHIFEEFD-E 978
            .:..|:...|.|.....|.:||...|::...|    ..|...|:|:|:.          :|.. |
Human   386 SMMAGVKCRLDSSLPPVRRLGMIVAEVVSARI----HPEGPPLKFQYEE----------DELSLE 436

  Fly   979 LGQFESPSKTKLDEKPCEDQLKQLELHLSDFMSTTEQKEPHKPNIEIQANPAPENQNVNMQLDSD 1043
            |....||       :|..|...  |...|...:|.|  .|.:...||.....|:.|....  |||
Human   437 LLALASP-------QPAGDGAS--EAGTSLVPATAE--PPAETPAEIVDGGVPQAQLAGS--DSD 488

  Fly  1044 DDEPLDEDDDELKPYDMSNDTTTTIDQRPKFVIDLLHLLREKVENYQVFEGALGTAEQLI-RGQL 1107
            .|     .|||..|||||.|......:.|.:|.|.:..|... |:.:.:|.||...|.|: |...
Human   489 LD-----SDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTS-EDIERWEAALRALEGLVYRSPT 547

  Fly  1108 AKHDTQLALDLLQLFLVMEMQFYYEQFERTQFKCCVAICVAHPGPCAEYLCRQFHTDNSFYSASV 1172
            |..  :::::|.::.|.:|.:.....|...:.:..||:.|..|.|.|:||..||:..|  ||...
Human   548 ATR--EVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALN--YSLRQ 608

  Fly  1173 RILILQVLAATAKELS-----------GDENMQNEMEIVDVIPPAAKHPRKFEFQQEEESPAARL 1226
            |:.||.||...|:|||           |..:..     ...:|.||           ...|.:.:
Human   609 RMDILDVLTLAAQELSRPGCLGRTPQPGSPSPN-----TPCLPEAA-----------VSQPGSAV 657

  Fly  1227 AAAQR-IIRDRLRAKTKRYFSK--PKAGDQMEKANPFHPVAGTFFFSL----------------- 1271
            |:..| ::.:|:|:||:| .||  |:.|.....:. |:.|||.|||.|                 
Human   658 ASDWRVVVEERIRSKTQR-LSKGGPRQGPAGSPSR-FNSVAGHFFFPLLQRFDRQGASRKIPLWL 720

  Fly  1272 ---VRGQRTRQMLYVKYEN----------------------------------ISHDI---DTQL 1296
               :|.|.:..||.:.:..                                  ::.|:   |..:
Human   721 SFAMRHQASAPMLGLWHGRQCRPHVPDAITCWALLASSCLSRRCTGPTFRAPLVTFDLLGEDQLV 785

  Fly  1297 LVNLLNTMSVLVMCSQNCPLLPAMTREIFDLCAFVRFNAEARVRAATLQLIGIALVTTPAHVLAQ 1361
            |..|.:|:..|:..:.|..:..||.:.:.:....:||:.:|.||...|..:...|::.||..|.:
Human   786 LGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLE 850

  Fly  1362 HFAESLNELQRWLNDFIRSPLVGGETSEECRELA 1395
            ...:.|.|.:.||.|....     :..|:||.||
Human   851 DLMDELLEARSWLADVAEK-----DPDEDCRTLA 879

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lqfRNP_732736.2 ENTH_epsin 27..150 CDD:239627
DUF4045 <226..459 CDD:289995
Telomere_reg-2 1072..1184 CDD:287202 34/113 (30%)
TELO2XP_011521075.1 Telomere_reg-2 512..620 CDD:287202 34/113 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4346
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177926at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.