DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lqfR and CLINT1

Sequence 1:NP_732736.2 Gene:lqfR FlyBaseID:FBgn0261279 Length:1415 Species:Drosophila melanogaster
Sequence 2:NP_001182484.1 Gene:CLINT1 HGNCID:23186 Length:643 Species:Homo sapiens

Alignment Length:641 Identity:232/642 (36%)
Similarity:307/642 (48%) Gaps:157/642 (24%)


  Fly     6 ISMWKVRELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWK 70
            ::|||||||.||.|||||||:|.|.|||||||||||||:|.||.|:|.:||.||.|||:|:|||.
Human     2 LNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWS 66

  Fly    71 RMLQDNKTNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTFTDEGGKDQGINVRHK 135
            |||:|||.||||.|||||||.||:||||||||||:|||||||||||||.|.||.|||||||:|.|
Human    67 RMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQK 131

  Fly   136 VRELIDFIQDDDRLREERKKAKKNKDKYIGMSSDAMGMRSGGYSGYSGGSGGGGGGSGGYNDGDY 200
            |:||::|.||||||||||||||||||||:|:|||::               ||...|..| |.:.
Human   132 VKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSV---------------GGFRYSERY-DPEP 180

  Fly   201 RSSRGDNWYSDKSA-----------DKDRYEDDDT--------HYDGEREGSDSDSPSPRRNYRY 246
            :|...:.|..:|||           ||.....|||        ..|.....||||.....|    
Human   181 KSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKAR---- 241

  Fly   247 NDRASPAEVASEAKPSSLNMNIRSKTVSSPVSKQPTSTASAKPALSQKKIDLGAAANF--GKPAP 309
            ..|:...|...|.:      .:.:|.:....:.:.|:|...:.|...|.|||||||::  .|.:|
Human   242 RGRSPKGEFKDEEE------TVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASP 300

  Fly   310 GGAAGIHSPTHRDTPTSVDLMGGASPSPSTSKANNNTQSNNNDLLDDLFKTCSPPPGQEKTLNSA 374
            ...|..|:| .....|||       ||..:|          .||: |||                
Human   301 DQNASTHTP-QSSVKTSV-------PSSKSS----------GDLV-DLF---------------- 330

  Fly   375 AVIVDDDDDFNPRASDASQQEFGDFASAFGQPSAGSTISEPPSTGLVPAANDEFADFAAFQGSTT 439
                    |...:::..|...||.||. ||..:|..:.   ||.....:.|.:|.|::||..:.:
Human   331 --------DGTSQSTGGSADLFGGFAD-FGSAAASGSF---PSQVTATSGNGDFGDWSAFNQAPS 383

  Fly   440 STSALDGNLLKTAT------------------PANDSFDLFNSAPTSTAAATTATDL-------- 478
            ...|..|....:|:                  .|::|.|||:...:|.|..|::..:        
Human   384 GPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTN 448

  Fly   479 LAGLGDLSIHQSMPM-----------------------AVEEQLASS-ND------------SMS 507
            ..||| |.:.:|.|:                       :|.:.|.|: :|            .|.
Human   449 TVGLG-LPMSRSQPLQNVSTVLQKPNPLYNQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQ 512

  Fly   508 SASPQPPSEAMRLAFSKAQKQLRDLMQVQSASAVAQVAAILGELHNSNALPGFTTP 563
            .:.||.||....:.....|:.:..:.|...|..::..:.:|.....:|||.|...|
Human   513 PSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMP 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lqfRNP_732736.2 ENTH_epsin 27..150 CDD:239627 95/123 (77%)
DUF4045 <226..459 CDD:289995 58/253 (23%)
Telomere_reg-2 1072..1184 CDD:287202
CLINT1NP_001182484.1 ENTH_epsin 23..146 CDD:239627 95/123 (77%)
Nucleoporin_FG 329..407 CDD:316182 21/106 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C317109789
eggNOG 1 0.900 E1_KOG2057
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H133740
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004790
OrthoInspector 1 1.000 T1073217
orthoMCL 1 0.900 OOG5_128219
Panther 1 1.100 LDO PTHR12276
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2102
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.