DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lqfR and TEL2

Sequence 1:NP_732736.2 Gene:lqfR FlyBaseID:FBgn0261279 Length:1415 Species:Drosophila melanogaster
Sequence 2:NP_011613.3 Gene:TEL2 SGDID:S000003331 Length:688 Species:Saccharomyces cerevisiae

Alignment Length:687 Identity:142/688 (21%)
Similarity:250/688 (36%) Gaps:204/688 (30%)


  Fly   690 VKAFFQLLISLPAQVANRLGRRLPETFAPVSYQKLLLRQWLKSLHFVLQCDDNREYFDLEP---- 750
            :||.|     ..:::.|.|..|:.    ...|...|..||    .|:|:.::.      :|    
Yeast   122 IKALF-----FGSKLFNVLANRID----MAKYLGYLRLQW----KFLLESNET------DPPGFL 167

  Fly   751 YSWLLSQ-AINLIYDVSTLESLLRVLKD-YAVAPRGRKVVHTILKELDPAACLKTAQSALSAGLN 813
            ..||:|. .:|.:.....|...|.:||: |..:          .:::..|:.|...:..::..|.
Yeast   168 GEWLVSSFLLNPVLAADMLLGELFLLKESYFFS----------FQKIISASSLIDQKRLIAKFLL 222

  Fly   814 LYVLIGAATLETPHWKHCLLQKLPLQRTPVDNKQLITLASYLNAVAPAQLQVLLNQLLGIWSKRI 878
            .|:.: ..|||..:....:|::..|.:       :|:| |.|..:....|:.::.:|:...|...
Yeast   223 PYIQV-IVTLENLNDVRKILRRFDLDK-------IISL-SVLFEIQSLPLKEVIVRLMSNHSSTK 278

  Fly   879 SLQKLGS--------QEHLAISKLLVLAAKCLCGNLVMDLN-IQRQ--LHD-----GLSNHLQSP 927
            .:..|.|        :......:||||.|       |.:|| .||:  .||     |::.||.|.
Yeast   279 FVSALVSKFADFTDEEVDTKTCELLVLFA-------VHNLNHSQREEIAHDERFLNGVTKHLGSN 336

  Fly   928 DALQRHVGMKTVELIFNFIALPDAKEDDRLRFEYDSFKDTFHWHIFE--EFDELGQFES---PSK 987
            :...|...|...:|:          ....|::|.| ||.......||  ..|::..|:|   ||.
Yeast   337 EREARERAMFIAKLL----------SGGHLKYESD-FKINIPNVKFESNSDDKIIDFQSLKNPSI 390

  Fly   988 TKLDEKPCEDQLKQLELHLSDFMSTTEQKEPHKPNIEIQANPAPENQNVNMQL-DSDDDEPLDED 1051
            ........:|::.::..|:                           |::.:.. ||||::..||.
Yeast   391 CNTQTDVGKDKITEVSGHV---------------------------QSLTLDCSDSDDEDENDER 428

  Fly  1052 D---------DELKPYDMSNDTTTTIDQRPKFVIDLLHLLREKVENYQVFEGALGTAEQLIRGQL 1107
            :         |.:|.|:.:.::...         .|:.||::.|              :|||   
Yeast   429 EIVKRIVFLKDLMKEYEKTGESRKA---------PLIPLLKQTV--------------KLIR--- 467

  Fly  1108 AKHDTQL-----ALDLLQLFLVMEMQFYYEQFERTQFKCCVAICVAHPGPCAEYLCRQFHTDNSF 1167
            .|.|.||     |..:|...:.:..:|....||:.:.....:|.|..|......:...|   ||.
Yeast   468 QKADFQLEVGYYAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILF---NSE 529

  Fly  1168 YSASVRILILQVLAATAKELSGDENMQNEMEIVDVIPPAAKHPRKFEF---------QQEEESPA 1223
            .|...|:.:|..|..:|:||.|       ::...::.|      ||:|         |....|..
Yeast   530 LSLQQRMSLLSALGLSARELRG-------LDDPTIVKP------KFDFPTNRLPWDDQSHHNSRL 581

  Fly  1224 ARLAAAQRIIRDRLRAKTKRYFSKPKAGDQMEKA--NPFHPVAGTFFFSLVRG------------ 1274
            ..:..:..:|:     |||..:...|.|...||.  |.|...||.||:.|..|            
Yeast   582 VEVQESTSMIK-----KTKTVWKSRKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQ 641

  Fly  1275 ------QRTRQMLYVKYENISHDID--TQLLVNLLNT 1303
                  ..|.:::| ...|..||.:  |:|:.:::::
Yeast   642 LFKSHYLTTLRIIY-SCANPVHDFESMTELMNHIISS 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lqfRNP_732736.2 ENTH_epsin 27..150 CDD:239627
DUF4045 <226..459 CDD:289995
Telomere_reg-2 1072..1184 CDD:287202 26/117 (22%)
TEL2NP_011613.3 Telomere_reg-2 434..546 CDD:287202 29/141 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4346
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.