DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lqfR and ENT5

Sequence 1:NP_732736.2 Gene:lqfR FlyBaseID:FBgn0261279 Length:1415 Species:Drosophila melanogaster
Sequence 2:NP_010437.3 Gene:ENT5 SGDID:S000002560 Length:411 Species:Saccharomyces cerevisiae

Alignment Length:515 Identity:109/516 (21%)
Similarity:178/516 (34%) Gaps:187/516 (36%)


  Fly    11 VRELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQD 75
            :|..|....||::.|...:..:|.|||.|.||||...:.::..:.:....:  :|:....:.|.|
Yeast    16 IRNAARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRYQVPLY--LMTEYTLKRLVD 78

  Fly    76 N-------------------KTNWRRTYKSLLLLNYLVRN---GSE----RVVTSSREHIYDLRS 114
            :                   .:.||...|.|:::.:|:.|   |.|    |....:.:||. .|.
Yeast    79 HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVDTGDELNQIRSCLLTHKHIL-TRE 142

  Fly   115 LENY--TFTDEGG---KDQGINVRHKVRELIDFIQDDDRLREERKKAKKNKDKYIGMSSDAMGMR 174
            :..:  .|:::|.   .::||  |.|...::.:::|...|::||.|.|||          |:.:|
Yeast   143 IAQFKVKFSNDGKMEIHERGI--RKKGELILQYLEDSQFLKKERAKNKKN----------ALKIR 195

  Fly   175 SGGYSGYSGGSGGGGGGSGGYNDGDYRSSRG-DNWYSDKSADKDRYEDDDTHYDGEREG------ 232
            ..|.|..             ||.....:|.. ||      .|.|.::.|...:|.|.:.      
Yeast   196 QQGESSI-------------YNANQISTSASYDN------IDDDEFDADADGFDSEMDANNVTNF 241

  Fly   233 -----SDSDSPSPRRNYRYNDRASPAEVASEAKPSSLNMNIRSKTVSSPVSKQPTSTASAKPALS 292
                 ::::|.:.||::....|....|:..|        .|::|.......:|..|         
Yeast   242 NVPVETEANSNTRRRSHMEEQRRQRREILRE--------QIKNKEQQRKRKQQQDS--------- 289

  Fly   293 QKKIDLGAAANFGKPAPGGAAGIHSPTHRDTPTSVDLMGGASPSPSTSKANNNTQSN-NNDLLDD 356
                                          .|..:||      ..|||..||.|..| |||    
Yeast   290 ------------------------------IPDLIDL------DDSTSTTNNITIDNGNND---- 314

  Fly   357 LFKTCSPPPGQEKTLNSAAVIVDDDDDFNPRASDASQQEFGDFASAFGQPSAGSTISEPPSTGLV 421
                     .:...:||.:   |||||           |||||.|           ...|.|...
Yeast   315 ---------NKNNNINSNS---DDDDD-----------EFGDFQS-----------ETSPDTTAP 345

  Fly   422 PAAN---DEFADFAAFQGSTTSTSALDGNL--------------LKTATPANDSF-DLFN 463
            ..:|   |:..|:...:..|.:|:|...:|              .|..:..||:| |||:
Yeast   346 KTSNSKIDDLLDWDGPKSDTDTTAAAQTSLPFAEKKQQKARPQATKDKSKGNDAFSDLFS 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lqfRNP_732736.2 ENTH_epsin 27..150 CDD:239627 32/154 (21%)
DUF4045 <226..459 CDD:289995 50/262 (19%)
Telomere_reg-2 1072..1184 CDD:287202
ENT5NP_010437.3 ENTH 30..180 CDD:279725 32/155 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.