DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lqfR and epn-1

Sequence 1:NP_732736.2 Gene:lqfR FlyBaseID:FBgn0261279 Length:1415 Species:Drosophila melanogaster
Sequence 2:NP_510458.1 Gene:epn-1 WormBaseID:WBGene00001329 Length:469 Species:Caenorhabditis elegans

Alignment Length:485 Identity:125/486 (26%)
Similarity:197/486 (41%) Gaps:137/486 (28%)


  Fly    17 KVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQDNKTNWR 81
            :|.||..|:::.:.||||||::|||||:..||.|:|..|.:...|.|:||::||| |.|:..|||
 Worm     9 QVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKR-LNDSGKNWR 72

  Fly    82 RTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTFTDEGGKDQGINVRHKVRELIDFIQDD 146
            ..||||:||::|::.|.|:|....||:::.:.:|:::... |..:|||:|:|.|.:::...:.||
 Worm    73 HVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHV-EDNRDQGLNIREKAKQITSLLSDD 136

  Fly   147 DRLREE-------RKKAKKNKDKYIGMSSDAMGMRSGGYSGYSGGSGGGGGGSGGYNDGDYRSSR 204
            :||:.|       |.|.|:|....:|..|    .||..:.......           |.:|..:|
 Worm   137 ERLKNERTRFILTRNKFKQNNPGPVGAES----RRSNRHHVTDASL-----------DPEYEDAR 186

  Fly   205 GDNWYSD---------------KSADKDRYEDD-------------------------------- 222
            ......:               :.||:.|..||                                
 Worm   187 PSTATEEEMQLQIALALSREECEKADEMRKSDDARLQMALEESQKLQDADRLATTKQGTVSSGQL 251

  Fly   223 -DTHYD-------GEREGSDSDSPSPRRNYRYNDRASPAEVASEAKPSSLNMNIRSKTVSSPVSK 279
             .:..|       ||....::|.||....:..||...       |..:|.::|...:..::.:|.
 Worm   252 TQSALDDLLSLGVGELVSGNNDQPSSSSAWGMNDPWG-------APQASASLNTNDQMFANSMSN 309

  Fly   280 Q---PTSTASAKPALSQKKIDLGAAANFGKPAPGGAAGIHSPTHRDTPTSVDLMGGASPSPSTS- 340
            .   .|||.:...|.:....|  ..|::..|||...    :|:...|.:|.||:||...||:.| 
 Worm   310 NDPWATSTVAQPVAATAPNSD--PFASWDAPAPAAT----TPSTMPTSSSFDLLGGDLLSPTNSL 368

  Fly   341 KANNNTQSNNNDLLDDLFKTCSPPPGQEKT------LNSAAVIVDDDDDFNPRASDASQQEFGDF 399
            .||.||.::.|              |..||      .||..|.:|                    
 Worm   369 SANINTNNSTN--------------GTRKTPENFLGENSNLVNLD-------------------- 399

  Fly   400 ASAFGQPSAGSTISEPPSTGLVPAANDEFA 429
             :..|..:..:|...|..||..||..:.||
 Worm   400 -NLLGSGTPSTTGGNPFLTGAAPANANPFA 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lqfRNP_732736.2 ENTH_epsin 27..150 CDD:239627 52/123 (42%)
DUF4045 <226..459 CDD:289995 52/222 (23%)
Telomere_reg-2 1072..1184 CDD:287202
epn-1NP_510458.1 ENTH_epsin 19..140 CDD:239627 52/123 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2102
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.