DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and rlmB

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_418601.1 Gene:rlmB / 948694 ECOCYCID:G7845 Length:243 Species:Escherichia coli


Alignment Length:236 Identity:59/236 - (25%)
Similarity:97/236 - (41%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 LKRALETFK-------RKQSVLIP------------ELAT-------SLAALNGNVQRKMNPVGD 967
            |:||.|.|:       |:...|:|            :||.       |..|::..:..::.| |.
E. coli    15 LERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEKSDGAVHQGIIARVKP-GR 78

  Fly   968 IYPESDFVVSNKARDDHELIVVASLIDKLPNLGGLARTCEVLGVNTLILGLKSQAEKSDFTNLSM 1032
            .|.|:|......:.|...|:::..:.|. .|||...|:.:..||:.:|:      .|.....|:.
E. coli    79 QYQENDLPDLIASLDQPFLLILDGVTDP-HNLGACLRSADAAGVHAVIV------PKDRSAQLNA 136

  Fly  1033 TAEKTL-----NILEVNPESLAGFLLEKQMEGYKIVGAEQTAHSTNFVDFKFPKKSILLLGHEKH 1092
            ||:|..     ::..:...:||..:...|.|...|||....|..|.: ..|...:..|::|.|..
E. coli   137 TAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLY-QSKMTGRLALVMGAEGE 200

  Fly  1093 GIPANLIGFLDYAVEIPQYGLVRSLNVHVAGSLFIWEYCKQ 1133
            |:........|..:.||..|.|.||||.||..:.::|..:|
E. coli   201 GMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 39/146 (27%)
rlmBNP_418601.1 PRK11181 1..243 CDD:183021 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.