DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and AT5G15390

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_197043.1 Gene:AT5G15390 / 831391 AraportID:AT5G15390 Length:350 Species:Arabidopsis thaliana


Alignment Length:155 Identity:36/155 - (23%)
Similarity:69/155 - (44%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   975 VVSNKARDDHELIVVASLIDKLPNLGGLARTCEVLGVNTL-ILGLKSQAEKSDFTNLSMTAEKTL 1038
            ||.|::   :.:.:|...:....|:....|:.:.||:.:: ::...|....:...::||.|||.|
plant   147 VVENRS---YSVCLVVEGLSDFGNISAAFRSADALGIQSVHVVSCDSSKRYNGNRHVSMGAEKWL 208

  Fly  1039 NI-LEVNPESLAGFLLEKQMEGYKIVGAEQTAHSTNFVDFKFPKKSILLLGHEKHGIPANLIGFL 1102
            :| ....|:.....|   :..||:|........:.:..|..:...:.:::|:|..||....:...
plant   209 DIEFWDTPKECFKVL---KSRGYRIATTHLGMDTVSIYDMDWSCPTAIVVGNEGRGISDEALELS 270

  Fly  1103 DYAVEIPQYGLVRSLNVHVAGSLFI 1127
            |....||..|:|.|.||.||..:.:
plant   271 DLRCSIPMNGMVDSFNVSVAAGILM 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 33/144 (23%)
AT5G15390NP_197043.1 SpoU <120..299 CDD:223640 36/155 (23%)
SpoU_methylase 154..296 CDD:278985 33/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002756
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.