DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and AT2G19870

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_849992.1 Gene:AT2G19870 / 816506 AraportID:AT2G19870 Length:589 Species:Arabidopsis thaliana


Alignment Length:203 Identity:40/203 - (19%)
Similarity:77/203 - (37%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   962 MNPVGDIYPESDFVVS---------------NKARDDHELIVVASLIDKLPNLGGLARTCEVLGV 1011
            :|.|.|..|....|:.               :...:.:.|.|....:....|||.:.|:....|.
plant   379 LNMVADNRPHQGLVLDASPLELVKVKELDPISSEEEKYSLWVALDEVTDPQNLGAIIRSAYFFGA 443

  Fly  1012 NTLILGLKSQAEKSDFTNLSMTAEKTLNILEVN-PESLAGFLLEKQMEGYKIVGAEQTAHSTNFV 1075
            ..:::..|:.|..|  ..:|..:..:|.::|:. .:::..||......|:::||...:..:....
plant   444 TGVVVCAKNSAPLS--AVVSKASAGSLEVMELRYCKNMMQFLEASAENGWRVVGGSVSPKAVALN 506

  Fly  1076 DFKFPKKSILLLGHEKHGIP----------ANLIGFLDYAVEIPQ-----------YGLVRSLNV 1119
            :......:||:||:|..|:.          ..:.|.:...|.:.:           :..|.||||
plant   507 EVLPGSPTILVLGNEGTGLRPLVERSCTDLVRISGNMPNEVAVTESDDAEGEGFRSFLAVESLNV 571

  Fly  1120 HVAGSLFI 1127
            .||..||:
plant   572 SVAAGLFL 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 35/164 (21%)
AT2G19870NP_849992.1 rRNA_methyl_3 314..579 CDD:129290 39/201 (19%)
SpoU_sub_bind 315..399 CDD:285300 5/19 (26%)
SpoU_methylase 420..580 CDD:278985 34/162 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.