| Sequence 1: | NP_651031.1 | Gene: | CG18596 / 42622 | FlyBaseID: | FBgn0038953 | Length: | 1136 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_899086.2 | Gene: | Mrm3 / 67390 | MGIID: | 1914640 | Length: | 418 | Species: | Mus musculus |
| Alignment Length: | 257 | Identity: | 51/257 - (19%) |
|---|---|---|---|
| Similarity: | 84/257 - (32%) | Gaps: | 71/257 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 929 LKRALETFKRKQSVLIPELATSLAALNGNVQRKMNPVGDIYPESDFVVSNKARDDHELIVVASLI 993
Fly 994 DKL---PNLGGLARTCEVLGVNTLILGLKS--QAEKSDFTNLSMTAEKTLNIL-----EVNPESL 1048
Fly 1049 -----------AGFLLEKQMEGYKIVGAEQTAHSTNFVDFK--------------FPKKSI---- 1084
Fly 1085 ---------LLLGHEKHGIPANLIGFLDYA----VEIPQYGLVRSLNVHVAGSLFIWEYCKQ 1133 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18596 | NP_651031.1 | SpoU_methylase | 986..1128 | CDD:278985 | 37/193 (19%) |
| Mrm3 | NP_899086.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 41..90 | ||
| SpoU | 117..407 | CDD:223640 | 51/257 (20%) | ||
| SpoU_sub_bind | 125..191 | CDD:214943 | 5/31 (16%) | ||
| SpoU_methylase | 209..398 | CDD:278985 | 37/191 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0566 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||