DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and mrm1

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001313395.1 Gene:mrm1 / 563095 ZFINID:ZDB-GENE-060526-229 Length:198 Species:Danio rerio


Alignment Length:168 Identity:42/168 - (25%)
Similarity:78/168 - (46%) Gaps:21/168 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   975 VVSNKARDDHELIVVASLIDKLPNLGGLARTCEVLGVNTLILGLKSQAEKSDFTNLSMTAEK-TL 1038
            :.|.:.::...|.:|...:....|||.:.|:...|||:.::..:.:...      |:.|..| :.
Zfish    26 ITSLEVKNQRPLWLVLDGVQDPMNLGAILRSAYYLGVDRIVSSINNSCP------LTPTVSKASA 84

  Fly  1039 NILEV----NPESLAGFLLEKQMEGYKIVGA---EQTAHSTNFV---DFKFPKKSILLLGHEKHG 1093
            .::||    ...:|...:..|..||:::||.   |:.:..:|.:   |||..:.::||:|.|..|
Zfish    85 GVMEVMDVFGCSNLKRMIKVKVEEGWQVVGTVGLEEGSSQSNVLSCSDFKMSRPTLLLMGGEGDG 149

  Fly  1094 IPANLIGFLDYAVEIP----QYGLVRSLNVHVAGSLFI 1127
            :.:.|....|..:.||    .:..|.||||.||..:.:
Zfish   150 LSSELRQLCDVLITIPPRRHMHPGVESLNVSVATGILL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 41/157 (26%)
mrm1NP_001313395.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.