DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and Mrm1

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_663408.2 Gene:Mrm1 / 217038 MGIID:2443470 Length:320 Species:Mus musculus


Alignment Length:294 Identity:69/294 - (23%)
Similarity:119/294 - (40%) Gaps:68/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   885 ARLLLPELGKQCPT-------SVSDCILMMTNAPFDENISFISCSYDFRMKLKRAL--------- 933
            :||||.:|   .|.       .:|.|:|.:..|               |.::.|.|         
Mouse    34 SRLLLDDL---APAQRLERLFGLSPCLLALRAA---------------RRRVARLLLQAGKAGLQ 80

  Fly   934 ----ETFKRKQSVLIPEL---ATSLAALNG-----NVQRKMNPVGDIYPESDFVVSNKARDDHEL 986
                |..:..::..||.|   ...|.||.|     .|..:::|:.. .|..:...::...|..:|
Mouse    81 GERAELLRVAEARGIPVLRPRRQKLDALCGYQVHQGVCMEVSPLRP-RPCDEAADTSSGDDPQQL 144

  Fly   987 IVVASLIDKLPNLGGLARTCEVLGVNTLILGLKSQAEKSDFTN-LSMTAEKTLNILEV--NPESL 1048
            .:|...:....|||.:.|:...|||:.:|   .||......|. :|..:...:.:::|  .|: |
Mouse   145 WLVLEGLQDPRNLGAVMRSAHFLGVDRVI---TSQRNSCPLTPVVSKASAGAMEVMDVFATPD-L 205

  Fly  1049 AGFLLEKQMEGYKIVGA------EQTAHS----TNFVDFKFPKKSILLLGHEKHGIPANLIGFLD 1103
            .|||..|..:|:.:||.      |.:..|    |:.::|.:.:.::|:||.|..|:...:.....
Mouse   206 PGFLQAKAQQGWLVVGTVGCPGPEISQSSKVPITSCLEFVWDRPTLLVLGSEGSGLSQEVFASCQ 270

  Fly  1104 YAVEI-PQYGL---VRSLNVHVAGSLFIWEYCKQ 1133
            ..:.| |:..|   :.||||.||..:.:...|.|
Mouse   271 LLLTILPRRHLPPGLESLNVSVATGILLHSICSQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 42/158 (27%)
Mrm1NP_663408.2 SpoU_sub_bind <78..125 CDD:285300 10/46 (22%)
SpoU <84..301 CDD:223640 54/221 (24%)
SpoU_methylase 146..299 CDD:278985 41/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.