DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18596 and AgaP_AGAP003655

DIOPT Version :9

Sequence 1:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_313427.5 Gene:AgaP_AGAP003655 / 1274325 VectorBaseID:AGAP003655 Length:461 Species:Anopheles gambiae


Alignment Length:236 Identity:50/236 - (21%)
Similarity:84/236 - (35%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   925 FRMKLKRALETFKRKQSVLIPELATSLAALNGNVQRKMNPVGDIYPE----SDFVVSNKARDDH- 984
            ||.|||.......::|:::.....|:...|.|           |:.|    |:.|..|...... 
Mosquito   228 FRAKLKACPIFLVKRQTMMEWSSLTTSPGLIG-----------IFGEPSNMSELVTRNATGSKRL 281

  Fly   985 ELIVVASLIDKLPNLGGLARTCEVLGVNTLILGLKSQAEKSDFTNLSMTAEKTLNILEVNPESLA 1049
            .:.||...|.:..|||.:.|:|..:.|..:|| ||..|...|...|...|.....:....|  :.
Mosquito   282 PVTVVCDNIREPNNLGSIVRSCAAVSVREVIL-LKGCAHPWDLKCLRGGAGAHFRVPIYGP--IE 343

  Fly  1050 GFLLEKQMEGYKIV----GAEQTAHSTNF-------VDFKFPKKSILLLGHEKHGIPANLIGFL- 1102
            .:.|.:.:....|.    ..:.|.....|       :|:......:|::|.|.:|:..::...: 
Mosquito   344 AYQLPEHVRAGSIFVVADNKKPTDERNGFRWKHYDRIDYGSADHVVLVIGGETYGVSDDIRSLIH 408

  Fly  1103 --------------DYAVEIPQYGLVRSLNVHVAGSLFIWE 1129
                          .:...||....|.|||...|.|:.::|
Mosquito   409 QLTQNDGEQAPQDRKFVAHIPLANGVESLNTASALSVILYE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 35/167 (21%)
AgaP_AGAP003655XP_313427.5 SpoU 185..452 CDD:223640 50/236 (21%)
SpoU_methylase 282..448 CDD:278985 35/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.