DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CIITA and CG8197

Sequence 1:XP_006720943.2 Gene:CIITA HGNCID:7067 Length:1229 Species:Homo sapiens
Sequence 2:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster

Alignment Length:445 Identity:91/446 (20%)
Similarity:142/446 (32%) Gaps:149/446 (33%)


Human   797 PPRAAESELAFPSFLLQCFLGALWLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLI 861
            |..|||....|...||.|     |..           :|      .||||..:.      ...|.
  Fly    16 PSPAAEKSRLFTILLLYC-----WQR-----------EY------DKRPYRQFQ------FKRLT 52

Human   862 FQPPA----RCLGALLGPSAAASVDRKQKVLARYLKRLQPGTLRARQL-LELLHCAHEAEEAGIW 921
            |:...    .|:             |..:::..||       ||..|| :::........:||:.
  Fly    53 FEERIGRRYHCI-------------RDLRIIVNYL-------LRRPQLSVQISSLVVSNWDAGLL 97

Human   922 QHVVQEL-----------------------------PGRLSFLGTRLTPPDAHVLGKAL------ 951
            :..|:.|                             ..:||..||.||..|..:|.:.|      
  Fly    98 KDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTL 162

Human   952 ------EAAGQDFSLDL------RSTGICPSGLGSLVGLSC---VTRFRAALSDTV---ALWESL 998
                  ..:...|:..|      :|.|:.......|:|:|.   ..:..:.||..:   .||...
  Fly   163 RRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALS 227

Human   999 QQHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKLEFAL 1063
            .:|.|.    .|::...|....|                ||.|.             .::|..|.
  Fly   228 LEHCEL----TAQDMIPIAEHLA----------------RTNSK-------------FRRLRIAC 259

Human  1064 GPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITD 1128
            ..: ||.....|:|.::...:|:.|||...|....|.|.|::..|:   .:.|:.|:|:.|   |
  Fly   260 NKI-GPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLAS---CRRLQVLHLNYN---D 317

Human  1129 LG--AYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLR-VMDVQY 1180
            :|  |..|..........|.:|:||.|......|..:.|:|...|.|. .:|:.|
  Fly   318 MGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDISY 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CIITAXP_006720943.2 NACHT 513..682 CDD:283404
LRR_RI 888..1213 CDD:238064 73/351 (21%)
leucine-rich repeat 1085..1112 CDD:275381 9/27 (33%)
leucine-rich repeat 1116..1154 CDD:275381 13/40 (33%)
leucine-rich repeat 1170..1200 CDD:275381 4/13 (31%)
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 9/27 (33%)
LRR_RI 137..374 CDD:238064 63/277 (23%)
leucine-rich repeat 162..189 CDD:275381 3/27 (11%)
leucine-rich repeat 202..220 CDD:275380 3/18 (17%)
leucine-rich repeat 223..251 CDD:275380 10/48 (21%)
leucine-rich repeat 252..279 CDD:275380 6/28 (21%)
leucine-rich repeat 280..307 CDD:275380 9/30 (30%)
leucine-rich repeat 308..335 CDD:275380 8/30 (27%)
leucine-rich repeat 336..357 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.