DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7084 and CG4630

Sequence 1:NP_001247235.2 Gene:CG7084 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:594 Identity:154/595 (26%)
Similarity:256/595 (43%) Gaps:79/595 (13%)


  Fly    23 MDVDDSEFNDPFQALMEKAGNHGRYQTLYNFVFVGGLAFSGAMIYMNIILALNIPDHWCTVPGRE 87
            :|.||         ::.:.|..||:|. .|::.:.......|...::.:.....|.:.|.||..:
  Fly    13 LDFDD---------ILVEIGEFGRFQR-RNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECD 67

  Fly    88 ---NTNFSLEEWRDITLPKQADNRGRKTFSNCEMFQMNFSEITD----WSAW------NSNLTKT 139
               :..:. ..|..|.:|.....||..|.|.||.|..|...:..    ||||      ..|.|..
  Fly    68 KLVDAEYG-ANWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTE 131

  Fly   140 TEACQNGWSYDKTWYESTIPTDHNWVCAKDL----FVTNVFVVGRVTEVAGSFILGQMGDSYGRR 200
            ||.| |.:.|..:  |.||.......|.::|    ||..:...|.   |.|:.:.|.:.|.|||:
  Fly   132 TERC-NQFVYGSS--ERTIVQQWGLQCPENLWKLAFVGTIHFAGL---VVGTALSGYLADRYGRK 190

  Fly   201 FVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGIVGLTVNSLFQSPQIIGMEISREEDRSRIAFFQ 265
            .::...:||.:|..:...: :..|..||..:.:..:..:.::....|||:|:.....|...:...
  Fly   191 HIFLFCIVFMALTGVAQAL-SWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVL 254

  Fly   266 SCGWSIGTTLMPLLYWWLRHWDSFMWLTSIPTAMVLLFSKYVIESPRWLISKQRFREAIVQLQKI 330
            :..:::|..|:.|.. :|..|.......|:|..:.:.:...|.||.|||:::.|..:|.|.:::.
  Fly   255 NYFYAVGEALLGLSV-FLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRA 318

  Fly   331 AKINGHRFDMTEKELAEIYSRDKQDVTYGIASLFAG----------W----RLARNTTIMG---- 377
            ||:|  |.|:: .||...:.:.:.|...|......|          |    .:||:..:||    
  Fly   319 AKVN--RRDIS-VELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAI 380

  Fly   378 --FSWCVVAVSYFTLVLFSSRMAGNPFLNFLYQSIVEIPAYVVGRYMGDTYGRRFTNSVSFLISF 440
              ..|.|.|:.|:.|.|.::.::||.:|||....:||||.|.:.......:|||...|.|.|:..
  Fly   381 LLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCS 445

  Fly   441 VTC-------------LPIIVYSTDERYE----NLMIYLATFIKFLNALTFFTVNLQ-CLEIYPT 487
            :||             :|... ..:.|:.    |.::.....:..|...:.|.|... ..|:.||
  Fly   446 ITCVASGFVTLAQGDWIPCQT-GVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPT 509

  Fly   488 CMRQTGVALGTILANAIGVLAPYLVYLGTTVDIRAPYYILGVLFLLGGIGALFLPETLHKKLPDT 552
            .:|..||.:.:..|....:|||::..|.:..| ..|..:.|.|.|:.|:.:|.||||.::|||||
  Fly   510 VIRSGGVGVMSTFARFGAMLAPFVPLLASYYD-PLPLLLFGTLSLVAGLLSLLLPETFNRKLPDT 573

  Fly   553 MEEAGHFGK 561
            :|||...||
  Fly   574 VEEAIALGK 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 140/543 (26%)
MFS 184..542 CDD:119392 98/396 (25%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 145/565 (26%)
MFS 158..533 CDD:119392 93/384 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1712
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24064
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.