DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SKIP and Inppl1

Sequence 1:NP_001262827.1 Gene:SKIP FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_075233.1 Gene:Inppl1 RGDID:68396 Length:1257 Species:Rattus norvegicus

Alignment Length:979 Identity:186/980 (19%)
Similarity:302/980 (31%) Gaps:351/980 (36%)


  Fly     7 VCEWLRALGLAQ-------------YAESFLDNGYDDLEI-------CKQVGDPDLDAIGVEN-- 49
            |..|..:.||.:             |.....:|...|.|.       .|::.|.|...|.:::  
  Rat   443 VTSWFTSKGLGKALDEVTVTIPHDIYVFGTQENSVGDREWLDLLRGGLKELTDLDYRPIAMQSLW 507

  Fly    50 ---------PAHRHKL----LKSIR-----SLREKGAASVYFMLNDPNSLSGSMEILCETPPNNE 96
                     |.|.:::    ..|::     :|..|||..|.||.|  .:..|.:.  |.....||
  Rat   508 NIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFN--GTSFGFVN--CHLTSGNE 568

  Fly    97 LELVLREQLETDGVRLTAHPYSTPPSSCLSDKEEDEIYGFGYGV-FAPRVARGGLTQQQQLLQQQ 160
             :...|.|...|.:||.:          |.|:   ::..|...: |......|.|..:..:..|:
  Rat   569 -KTTRRNQNYLDILRLLS----------LGDR---QLSAFDISLRFTHLFWFGDLNYRLDMDIQE 619

  Fly   161 TLQ-------------TQQSIQQQQQQ--MQQQQQQLPIVPG-QQQQGPHQ----HQTLPPNV-- 203
            .|.             .|.::::::.:  ::..::::...|. :.::|...    |:..|..|  
  Rat   620 ILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRT 684

  Fly   204 ----------------AHL-----------------------------NFVQQNCLSPRSAYFY- 222
                            .|:                             .|:.:..||..|...| 
  Rat   685 NVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYI 749

  Fly   223 EFPPTAEGRETKKRTTLARLLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSF 287
            ||.......:|..||..  .::...|.....:.:.:|.||:                        
  Rat   750 EFESIEAIVKTASRTKF--FIEFYSTCLEEYKKSFENDAQS------------------------ 788

  Fly   288 EETIHRLKVQEAMRKKEKFQREHEEILRDIR----QGLLQMSRGEGRMDDTYMYDEALRTGGGMG 348
            .:.|:.||||.:.|:....    :.||.||.    |.||...:.   ||....|.|.        
  Rat   789 SDNINFLKVQWSSRQLPTL----KPILADIEYLQDQHLLLTVKS---MDGYESYGEC-------- 838

  Fly   349 IAGLGMPLGVGGNGGGGGAAHYAVSALHHQGH------------------WYDEPPYE---SDPD 392
            :..|...:        |..|...::.|.|:|.                  ...|..||   .|.|
  Rat   839 VVALKSMI--------GSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKD 895

  Fly   393 DFLMAGLNCGPAATIQGGRVRFSNNRESTGVISLRSAGDISL----PQRGPPRRGLIVPQQPPNP 453
            |   .|......:.::|.:...|.:|:.|   |..::..:|.    |::.||      ..:||.|
  Rat   896 D---TGAKSKAPSVLRGSQEHRSGSRKPT---STEASCPLSKLFEEPEKPPP------TGRPPAP 948

  Fly   454 PTIIPLTHARSHDRESGDYAGSISDLQSVTSRFSTVSIGTNNCTARYRTLSGGIGESPSL-SPSP 517
            |..:|        ||           :|:..|..                |.|..|...: :|.|
  Rat   949 PRAVP--------RE-----------ESLNPRLK----------------SEGTPEQEGVAAPPP 978

  Fly   518 SSDYEDIG--VTRG--HGCLP--PSLLAAKAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGA 576
            .:.:.:..  |..|  |..||  |:..|    :..:|....|.:.........|..|        
  Rat   979 KNSFNNPAYYVLEGVPHQLLPLEPTSFA----RAPIPPTTKNKVAITVPAPQLGRHR-------- 1031

  Fly   577 FNENGRNFVATKDTSRDFSNSQDNTDRGS-----------MSDQA-FACSASSVESLPSASGSST 629
                         |.|....|..:.|.|.           :.|.| |........|:|...|.|.
  Rat  1032 -------------TPRVGEGSSSDEDSGGTLPPPDFPPPPLPDSAIFLPPNLDPLSMPVVRGRSV 1083

  Fly   630 ---------QALVRP-----GSPHSSI-----SAEDRTSMASCICKAKALVD---------SLPN 666
                     :|..||     .||.|:.     ||:||:.....:.|..:.||         .|||
  Rat  1084 GEARGPPPPKAHPRPPLPPGTSPASTFLEEVASADDRSCSVLQMAKTLSEVDYSPGPGRSALLPN 1148

  Fly   667 PYDKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGSRLA 731
            |.:   |:..:|.               ..:||...|        |..|::.|..:.||..:...
  Rat  1149 PLE---LQLPRGP---------------SDYGRPLSF--------PPPRIRESIQEDLAEEAPCP 1187

  Fly   732 NSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADLDYLGILNQEHRAKLLT 796
            ..|..| ..|...:...|..|||:.|....|.||::|||...::...||:..|:.:..|:..||.
  Rat  1188 QGGRAS-GLGEAGMGAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLD 1251

  Fly   797 AVQL 800
            .:||
  Rat  1252 TLQL 1255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 16/98 (16%)
SAM 7..65 CDD:197735 16/98 (16%)
SH3 657..710 CDD:302595 11/62 (18%)
SAM 738..801 CDD:197735 20/64 (31%)
SAM_superfamily 742..800 CDD:301707 18/58 (31%)
Inppl1NP_075233.1 SH2_SHIP 17..119 CDD:198206
INPP5c_SHIP2-INPPL1 425..728 CDD:197335 47/303 (16%)
SH3-binding 945..950 4/5 (80%)
NPXY motif 984..987 0/3 (0%)
SAM_Ship2 1193..1255 CDD:188890 20/63 (32%)
SAM 1201..1257 CDD:197735 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.