DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SKIP and SAMSN1

Sequence 1:NP_001262827.1 Gene:SKIP FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_001243299.1 Gene:SAMSN1 HGNCID:10528 Length:441 Species:Homo sapiens

Alignment Length:466 Identity:119/467 (25%)
Similarity:207/467 (44%) Gaps:104/467 (22%)


  Fly   450 PPNP---------PTIIPLTHARS---HDRESGDYAGSISDLQSVTSRFSTVSIGTNNCTARYRT 502
            |.||         ..:.|..|..|   |.|    ...|.||:..:.| :.:.|.|..:   |:| 
Human    44 PENPLWTCLDFQIAQVGPWDHCSSCIRHTR----LKSSCSDMDLLHS-WRSSSFGNFD---RFR- 99

  Fly   503 LSGGIGESPSLS-PSPSSDYEDIGVTRGHGCLPPSLLAAKAKKNGLPHGKANTICQKATVHHSGE 566
                   :.||| |..|::..:...|.|.|      ..:|...||...||              :
Human   100 -------NNSLSKPDDSTEAHEGDPTNGSG------EQSKTSNNGGGLGK--------------K 137

  Fly   567 MRSSA----KEIGAFNENGRNFVATKDTSRDFSNSQD-----NTDR--GSMSDQAFACSASSVES 620
            ||:.:    |::      |:.::......:|..:.::     |:|.  |:.:::....::.|::|
Human   138 MRAISWTMKKKV------GKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDS 196

  Fly   621 LPSASGSST--QALVRPGSPHSSISAEDRTSMASCIC-KAKALVDSLPNPYDKEALKFKKGDLID 682
            |.|...||:  .:.....|...|...:|....:...| :|:...|..|:|||.::||.||||:||
Human   197 LYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIID 261

  Fly   683 VLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGSRLANSGNGSHNGGPCSVED 747
            ::.....|:|.|..:.:||:||||.|:|:.|:   .::.|.:.| :|.:||....      ::::
Human   262 IICKTPMGMWTGMLNNKVGNFKFIYVDVISEE---EAAPKKIKA-NRRSNSKKSK------TLQE 316

  Fly   748 LLIRIGLKEYTSVFVLNGYEDLELFKELEPADLDYLGILNQEHRAKLLTAVQ--LLHDIECSDVD 810
            .|.||.|:||||..:|||||.||..|:::.:.|..|.|.|.:.|.:||:|.:  |..:|.....:
Human   317 FLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQEN 381

  Fly   811 IPGSSSENDEARLNNINMKHGASPFGRRHFPRDSGCYEGSPLPSSQTPTQAVNSTDESNSLDDVV 875
            .|...|.:.:..||...:.         ..|||||||              ::|.:..|..:|:.
Human   382 EPEPLSLSSDISLNKSQLD---------DCPRDSGCY--------------ISSGNSDNGKEDLE 423

  Fly   876 TKCSSEIMKRV 886
            ::..|:::.::
Human   424 SENLSDMVHKI 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926
SAM 7..65 CDD:197735
SH3 657..710 CDD:302595 24/53 (45%)
SAM 738..801 CDD:197735 25/65 (38%)
SAM_superfamily 742..800 CDD:301707 24/60 (40%)
SAMSN1NP_001243299.1 SLY 88..232 CDD:289268 34/181 (19%)
SH3 235..286 CDD:302595 23/51 (45%)
SAM_SAMSN1 307..371 CDD:188960 26/70 (37%)
SAM 312..371 CDD:197735 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130050
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12301
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5033
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.