DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SKIP and sash3

Sequence 1:NP_001262827.1 Gene:SKIP FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_001016498.1 Gene:sash3 XenbaseID:XB-GENE-1016821 Length:389 Species:Xenopus tropicalis

Alignment Length:409 Identity:117/410 (29%)
Similarity:182/410 (44%) Gaps:96/410 (23%)


  Fly   518 SSDYEDIGVTRGHGCLPPSLLAAKAK---KNGLPHGKANTICQKATVHHSGE------------- 566
            ||.::|.|.::     |.|.:.::.:   :|.:|..:|.....: ....||:             
 Frog    23 SSSFKDFGKSK-----PSSPVVSEKEFNLENDIPEDEAGVTADE-NKQSSGKLSKKWRAVISRTM 81

  Fly   567 --------MRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDNTDRGSMSDQAFACSASSVESLPS 623
                    |::.|.|||            :.|.   .:|..:|| ||: |.....|:...|:|.|
 Frog    82 NRKMGKEVMKAMAHEIG------------EPTG---PSSPISTD-GSI-DGMHRKSSDPEENLHS 129

  Fly   624 ASGSSTQALVRPGSPHSSISAEDRTSMASC-------IC-KAKALVDSLPNPYDKEALKFKKGDL 680
            .....|.:.....||...|:..|..::.:.       .| |||...|.:|:|||.::||.||||:
 Frog   130 PVSRQTSSGSEVFSPSFMINNRDSINLENLPPPYNGPFCGKAKVHTDFIPSPYDGDSLKLKKGDI 194

  Fly   681 IDVLSMNASGIWKGRCHGRVGHFKFINVEVLPE--QRMKNSSSKTLAAGSRLANSGNGSHNGGPC 743
            ||::.....|.|.|....::|.||||.|:::||  :..|.:.::|.....|..          |.
 Frog   195 IDIIEKPPVGTWTGMLRNKIGSFKFIYVDLVPEETETPKKTKTRTKVRSKRQK----------PK 249

  Fly   744 SVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADLDYLGILNQEHRAKLLTAVQLLHDIECSD 808
            :|::||.||.::|:....:|||||.:|.||:|....|..|.|.:.:||.|||||.:.|.|.:   
 Frog   250 TVQELLERINMQEHIPTLLLNGYETIEDFKDLSENHLIELNITDPQHRVKLLTAAEFLLDYD--- 311

  Fly   809 VDIPGSSSENDEARLNNINMKHGASPFGRRHFPRDSGCYEGSPLPSSQTPTQAVNSTDESN--SL 871
                 :.||. |...:..:|:|..      |.||||||||||        ....||.|::.  |:
 Frog   312 -----TGSET-EGMTDTSSMEHSI------HIPRDSGCYEGS--------ENLENSRDDNEIISI 356

  Fly   872 D-DVVTKC---SSEIMKRV 886
            | |:...|   |:|:...|
 Frog   357 DEDIKNLCLVESTEVKHAV 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926
SAM 7..65 CDD:197735
SH3 657..710 CDD:302595 24/53 (45%)
SAM 738..801 CDD:197735 26/63 (41%)
SAM_superfamily 742..800 CDD:301707 26/58 (45%)
sash3NP_001016498.1 SLY 19..167 CDD:289268 32/167 (19%)
SH3_SASH3 169..224 CDD:212901 25/55 (45%)
SAM_SASH-like 247..306 CDD:188892 26/69 (38%)
SAM 248..310 CDD:197735 28/62 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T129094
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5033
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.