DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SKIP and CG17625

Sequence 1:NP_001262827.1 Gene:SKIP FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_651078.1 Gene:CG17625 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster

Alignment Length:136 Identity:43/137 (31%)
Similarity:65/137 (47%) Gaps:31/137 (23%)


  Fly     7 VCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREKGAASV 71
            |.:||..|.:.:|...||:.|||.:|.||.:...||..:||:|||||..||:.:|          
  Fly     6 VRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR---------- 60

  Fly    72 YFMLNDPNSLSGSMEILCETP--PNNELELVLREQLE----------TDGVRLTAHPYS-TPPSS 123
             |::|.|.      :.:|:.|  .:.|:||.|...:|          .|.:. |..||| |.|..
  Fly    61 -FLVNAPE------QFICKEPCELHEEIELKLDPDVELFASLKCLENVDFLE-TPVPYSLTSPQK 117

  Fly   124 CLSDKE 129
            .|:.::
  Fly   118 TLTTRD 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 25/58 (43%)
SAM 7..65 CDD:197735 25/58 (43%)
SH3 657..710 CDD:302595
SAM 738..801 CDD:197735
SAM_superfamily 742..800 CDD:301707
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 26/69 (38%)
SAM 6..64 CDD:197735 26/69 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4384
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12301
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.