DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKIP and CG17625

DIOPT Version :10

Sequence 1:NP_001262827.1 Gene:SKIP / 42601 FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster


Alignment Length:135 Identity:43/135 - (31%)
Similarity:65/135 - (48%) Gaps:29/135 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREKGAASV 71
            |.:||..|.:.:|...||:.|||.:|.||.:...||..:||:|||||..||:.:|          
  Fly     6 VRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR---------- 60

  Fly    72 YFMLNDPNSLSGSMEILCETP--PNNELELVLREQLE-------TDGVRL--TAHPYS-TPPSSC 124
             |::|.|.      :.:|:.|  .:.|:||.|...:|       .:.|..  |..||| |.|...
  Fly    61 -FLVNAPE------QFICKEPCELHEEIELKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKT 118

  Fly   125 LSDKE 129
            |:.::
  Fly   119 LTTRD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 25/57 (44%)
SH3 657..710 CDD:473055
SAM_superfamily 742..800 CDD:472832
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 26/68 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.