DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKIP and CG17625

DIOPT Version :9

Sequence 1:NP_001262827.1 Gene:SKIP / 42601 FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster


Alignment Length:135 Identity:43/135 - (31%)
Similarity:65/135 - (48%) Gaps:29/135 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREKGAASV 71
            |.:||..|.:.:|...||:.|||.:|.||.:...||..:||:|||||..||:.:|          
  Fly     6 VRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR---------- 60

  Fly    72 YFMLNDPNSLSGSMEILCETP--PNNELELVLREQLE-------TDGVRL--TAHPYS-TPPSSC 124
             |::|.|.      :.:|:.|  .:.|:||.|...:|       .:.|..  |..||| |.|...
  Fly    61 -FLVNAPE------QFICKEPCELHEEIELKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKT 118

  Fly   125 LSDKE 129
            |:.::
  Fly   119 LTTRD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 25/57 (44%)
SAM 7..65 CDD:197735 25/57 (44%)
SH3 657..710 CDD:302595
SAM 738..801 CDD:197735
SAM_superfamily 742..800 CDD:301707
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 26/68 (38%)
SAM 6..64 CDD:197735 26/68 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4384
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.