DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SKIP and Caskin2

Sequence 1:NP_001262827.1 Gene:SKIP FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_542374.2 Gene:Caskin2 MGIID:2157062 Length:1201 Species:Mus musculus

Alignment Length:853 Identity:174/854 (20%)
Similarity:256/854 (30%) Gaps:283/854 (33%)


  Fly     2 AVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREK 66
            |:.|    ||....|..|...||..|||...|.:...: ||.||||..|.||.|:...|..|   
Mouse   492 AIHN----WLSEFQLEGYTAHFLQAGYDVPTISRMTPE-DLTAIGVTKPGHRKKIASEIAQL--- 548

  Fly    67 GAASVYFMLNDPNSLS-GSMEILCETP-PNNELELVLR-------------EQLETDGVRLTAHP 116
               |:...|  ||.:. ..:|.||... |....:||..             |:|:..||....|.
Mouse   549 ---SIAEWL--PNYIPVDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQ 608

  Fly   117 YSTPPS-SCLSDKEEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQ 180
            ...... ..|::.....::|...|....|:.||     .:|:..:.|:..:              
Mouse   609 KKLMLGVKRLAELRRGLLHGEALGEGGRRMTRG-----PELMAIEGLENGE-------------- 654

  Fly   181 QLPIVPGQQQQGPH----QHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLAR 241
                  |....||.    |...|.|.:       |..::...:.....||.              
Mouse   655 ------GPTTAGPRLLTFQGSELSPEL-------QAAMAGGGSEPLPLPPA-------------- 692

  Fly   242 LLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAMRKKEKF 306
                      |..:.:..||::|                 |..||.|:.:.:..|.:....:|  
Mouse   693 ----------RSPSQESIGARSR-----------------GSGHSQEQPVPQPSVGDPSAPQE-- 728

  Fly   307 QREHEEILRDIRQGLLQMSR------GEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVG---GNG 362
                    |::.:|..:.|:      |:|.....:|..:.|.:.     ...|.|.||.   ...
Mouse   729 --------RNLPEGTERPSKLCSPLPGQGPAPYVFMCPQNLPSS-----PAPGPPPGVPRAFSYL 780

  Fly   363 GGGGAAHYAVSALHHQGHWYDEP-PYESDPDDFLMAGLNCGPAATIQGGRVRFSNNRESTGVISL 426
            .|..||.........:.|....| |.|.:.:     |...||..:..|.   ::......|..:|
Mouse   781 AGSPAAPPDPPRPKRRSHSLSRPGPAEGEAE-----GEAEGPVGSALGS---YATLTRRPGRSTL 837

  Fly   427 RSAGDISLPQRGPP----------RRGLIVPQQPPNPP----TIIPLTHARSHDRESGDYAGSIS 477
            ........|.||.|          |:|     .||.||    ::...|...|.|..||...|:..
Mouse   838 ARTSPSLTPTRGTPRSQSFALRARRKG-----PPPPPPKRLSSVSGSTEPPSLDGTSGPKEGATG 897

  Fly   478 DLQSVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPS----PSSDYEDIGVTRGHGCLPPSLL 538
                                .|.||||...|.|.|..||    |.||.|:.....|   .|||  
Mouse   898 --------------------PRRRTLSEPTGPSESPGPSAPTGPVSDTEEEPGPEG---TPPS-- 937

  Fly   539 AAKAKKNGLPHGKANTICQKATVHHSG----------------------EMRSSAKE-------- 573
             ..:...|||..:...:..|.....:|                      :.|...||        
Mouse   938 -RGSSGEGLPFAEEGNLTIKQRPKPAGPPPRETPVPPGLDFNLTESDTVKRRPKCKEREPLQTAL 1001

  Fly   574 -----IGAFNENGRNFVATK---DTSRDFSNSQDNTDRGSMSDQAFACSASSVESL--------P 622
                 :|:......|.::|:   |.....||....::...:..|  ..||||:.|:        |
Mouse  1002 LAFGVVGSDTPGPSNPLSTQAPCDPPSASSNPPQRSEPSVLPSQ--GTSASSLSSVTQSPGHPGP 1064

  Fly   623 SA-------SGSSTQALVRPGSPHSSI----SAEDRTSMASCICKAKA-----LVDSL-PNPYDK 670
            ||       :||.......|.:|.:::    .|.......|..|...|     |...| |.|...
Mouse  1065 SAGPALANSTGSKPNVETEPPAPPAALLKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPP 1129

  Fly   671 EALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGSRLANSGN 735
            ...:            |...:    |.||.            :||::.:|| :|.|..|.|....
Mouse  1130 PRPE------------NTGPV----CPGRA------------QQRLEQTSS-SLEAALRAAEKSI 1165

  Fly   736 GS-HNGGP 742
            |: ...||
Mouse  1166 GTEERDGP 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 23/61 (38%)
SAM 7..65 CDD:197735 22/58 (38%)
SH3 657..710 CDD:302595 9/59 (15%)
SAM 738..801 CDD:197735 2/6 (33%)
SAM_superfamily 742..800 CDD:301707 1/2 (50%)
Caskin2NP_542374.2 ANK 7..135 CDD:238125
Ank_4 7..61 CDD:290365
ANK repeat 7..46 CDD:293786
ANK repeat 48..79 CDD:293786
ANK 1 48..77
Ank_2 53..145 CDD:289560
ANK 76..209 CDD:238125
ANK 2 81..110
ANK repeat 85..112 CDD:293786
ANK repeat 114..145 CDD:293786
ANK 3 114..143
ANK 4 147..176
Ank_2 152..251 CDD:289560
ANK repeat 158..219 CDD:293786
ANK 183..311 CDD:238125
ANK 5 188..217
ANK 6 220..249
ANK repeat 221..251 CDD:293786
SH3_Caskin2 284..345 CDD:212996
SAM_caskin1,2_repeat1 487..552 CDD:188896 25/71 (35%)
SAM 493..548 CDD:197735 22/60 (37%)
SAM_caskin1,2_repeat2 553..623 CDD:188897 15/72 (21%)
SAM 561..620 CDD:197735 12/59 (20%)
Caskin-Pro-rich 797..881 CDD:293512 21/97 (22%)
Caskin-tail 1144..1201 CDD:293238 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.