DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SKIP and wwp2

Sequence 1:NP_001262827.1 Gene:SKIP FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_001090841.1 Gene:wwp2 XenbaseID:XB-GENE-961516 Length:729 Species:Xenopus tropicalis

Alignment Length:412 Identity:74/413 (18%)
Similarity:127/413 (31%) Gaps:147/413 (36%)


  Fly    29 DDLEIC-----KQVGDPDLDAIGVENPAHRHKLLKSIRS-------------LREKGAASVYFML 75
            |||.|.     :.|.|.|.:.: .||   .|..|:.|.|             ..:...:::..::
 Frog    42 DDLTIALDEHMEAVEDADSEMV-FEN---GHYALEKISSPPQSASSDSSQPIKNQDNTSNITVLV 102

  Fly    76 NDPNSLSGSMEILCETPPNNEL-------------ELVLREQLETDGVR---LTAHPYSTPPSSC 124
            |..:|.:.|.|:  :.|..:|.             ||...:..:|..::   ||......||...
 Frog   103 NGESSHATSSEL--DVPAQDEAFSNISSPLPSLGSELRSEDNEDTQSLQPSALTPTSEGLPPGWE 165

  Fly   125 LSDKEEDEIYGFGYGV------------FAPRVARGG---------LTQQQQLLQQQTLQTQQSI 168
            ..:.....:|...:..            :..||...|         .|...|....:.::..:..
 Frog   166 QRELSNGRVYYVDHNTKSTTWERPLPLGWEKRVDNRGRFYYVDHNTRTTTWQRPTAEYVRNYEQW 230

  Fly   169 QQQQQQMQQQQQQL---------PIVPGQQQQGPHQHQTLP---------PNVAHLN-------- 207
            |.|:.|||...|||         ...|.....||     ||         ..|.::|        
 Frog   231 QSQRNQMQGAMQQLSQRFLYQPSSAAPDNDPLGP-----LPNGWEKRQDNGRVYYVNHNTRTTQW 290

  Fly   208 -------FVQQNCLSPRSAYFYEFPPTAEG-----RETKKRTTLARLLKGLKTVNRRDRNNQQNG 260
                   .:|:..|.|.    :|...|:||     ...|:.||.           :..|....:|
 Frog   291 EDPRTQGMIQEPALPPG----WEMKYTSEGIRYFVDHNKRATTF-----------KDPRPGFDSG 340

  Fly   261 AQARAANDRLRHFQMINGGAGGQQHSFEETIHRLK-----------VQEAMRKKEKFQREHEEIL 314
            .:.             .|..|....||....|:.:           |:.::.::..|:...::|:
 Frog   341 VKQ-------------GGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIM 392

  Fly   315 R----DIRQGLLQMSRGEGRMD 332
            .    |:|:.|..:.|||..:|
 Frog   393 NMKPYDLRRRLYIIMRGEEGLD 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 13/54 (24%)
SAM 7..65 CDD:197735 13/54 (24%)
SH3 657..710 CDD:302595
SAM 738..801 CDD:197735
SAM_superfamily 742..800 CDD:301707
wwp2NP_001090841.1 WW 160..189 CDD:278809 3/29 (10%)
WW 190..219 CDD:278809 5/29 (17%)
WW 264..294 CDD:197736 5/35 (14%)
WW 305..335 CDD:238122 9/45 (20%)
HECTc 375..727 CDD:238033 9/41 (22%)
HECTc 398..726 CDD:214523 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.