DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13409 and tmem181

DIOPT Version :8

Sequence 1:NP_651004.1 Gene:CG13409 / 42592 FlyBaseID:FBgn0038926 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_005168570.1 Gene:tmem181 / 557799 ZFINID:ZDB-GENE-060503-309 Length:530 Species:Danio rerio

Alignment Length:534 Identity:253/535 (47%)
Similarity:350/535 (65%) Gaps:28/535 (5%)


  Fly    24 LLLRLKSSLSQFSDLFSDFSRYISPAYHHDRCERSVHMRLYSMHKREFVMVFLGFFTCFGLGIVI 88
            |:..:|......::..::....::| |.::|..|...||||::.||.||:||:.||.||||..:|
Zfish    15 LVGEMKRFCRNITEACNELKEELTP-YRNERFYRLAPMRLYTLSKRHFVLVFVVFFFCFGLSTLI 78

  Fly    89 GLTGPPITSTSSLTAQQILANTSLAHSPTVLGKGPFAMKSPLTTTYSQQMWLIAKLVTDNNDDER 153
            ||:||.|.|.:..        ..|:.||.....||||..||..:.|:||:||...:...||..:.
Zfish    79 GLSGPKIISENHY--------NGLSVSPNGSKIGPFAFSSPPLSNYNQQLWLTCIIELQNNIVDL 135

  Fly   154 YDKSFQVSVSIDGINEQHKPQSVLGSGVAHNRTRHLVCVRND--CEEFTVMHLGFLDYAHYIITV 216
            ..:.|.::|.:.|:.:......:  |...|||.|.|.|..:.  |:|..|:|||:|:|..|.|.|
Zfish   136 SWREFGMNVELQGVVQDTSVMRI--SDNVHNRNRSLHCSAHQQACDEIIVLHLGYLNYTQYKINV 198

  Fly   217 RFYGLESFHQKYNIRSITFYFKTYSPDFTQIEIWFRCIFLLFTFIVICWYAHTLRKYPIYDWSIE 281
            .|..|:. ..|.||:::||.||.|...|:|:|||||.:|::.||||.|.:||:|||:.:.||.||
Zfish   199 SFRNLQD-DLKDNIKNVTFVFKMYQDTFSQMEIWFRFVFVVMTFIVTCMFAHSLRKFSMRDWGIE 262

  Fly   282 QRWLSVLLPLLLLYDNPFFPLIFLMNSWLPGMLDAILQATFLCALLMFWLCIYHGLR-QNERSFV 345
            |:|:|:||||||||::|||||.||:|||.||.|||.|||.||||||:||||:|||:| |.||.|:
Zfish   263 QKWMSILLPLLLLYNDPFFPLSFLVNSWFPGTLDAFLQAVFLCALLLFWLCVYHGIRVQGERRFL 327

  Fly   346 RFYLVKVIVVLPIWLCAIVLATWEKCNELRDPTYSHFVDTKNYNGFKMFFYIACCMYVLYLVLLL 410
            .|||.|:::|..:||.|:.|..|:..|||:||||.:.||.:|:.|.|:||.:..|:||||||.|:
Zfish   328 TFYLPKLLMVGLLWLSAVTLGIWQTVNELQDPTYQYKVDIQNFQGMKIFFLLVVCVYVLYLVFLV 392

  Fly   411 LRAYTELRSMPYFDMRLKFLTLLMLFVLSISITVTTCRFGFGILEDNFVASLNTTYRSSAQFMCF 475
            :||.:||::|||.|:||||||.|.|.||.||:.:...|||...|:|||||.|:|.|::||:|:.|
Zfish   393 VRACSELKNMPYSDLRLKFLTALTLVVLVISVIILYLRFGSKALQDNFVAELSTHYQNSAEFLSF 457

  Fly   476 YGLLNFYLYTMAYVYSPD-GRFAQAELAVTKDNPAISMIDDSDEDVVYGSDEESRRPLTSVGGGA 539
            ||||||||||:|:||||. .....::|   |||||.||::|||::|:||||.| ..||.:  |.|
Zfish   458 YGLLNFYLYTLAFVYSPSKNALYDSQL---KDNPAFSMLNDSDDEVIYGSDYE-EMPLQN--GRA 516

  Fly   540 GK------NDYDSD 547
            .|      ::.|||
Zfish   517 IKATAKYQDESDSD 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13409NP_651004.1 MIG-14_Wnt-bd 195..492 CDD:284153 172/300 (57%)
tmem181XP_005168570.1 MIG-14_Wnt-bd 178..476 CDD:284153 173/299 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214172309
eggNOG 1 0.900 E1_28HK3
Hieranoid 1 1.000
Homologene 1 1.000 H44787
Inparanoid 1 1.050 480 1.000 Inparanoid score I1398
OMA 1 1.010
OrthoDB 1 1.010 D299250at33208
OrthoFinder 1 1.000 FOG0007184
OrthoInspector 1 1.000 T1053167
orthoMCL 1 0.900 OOG5_131448
Panther 1 1.100 LDO PTHR31918
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5374
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.