DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6028 and Fahd2a

Sequence 1:NP_651002.3 Gene:CG6028 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_083905.1 Gene:Fahd2a MGIID:1915376 Length:313 Species:Mus musculus

Alignment Length:288 Identity:127/289 (44%)
Similarity:177/289 (61%) Gaps:3/289 (1%)


  Fly     6 MRFVQYLRKGDLAKRLGLLSEDQKSLVEFAGLEG-VPSDLKILIAQDPNLEELAKKA-EKQPRLE 68
            ||.||:.........|||.|.....:|:....:. :|..:...:.|......:|::| ..|..:.
Mouse    27 MRLVQFQAPHLEEPHLGLESGVGGGVVDLNAFDSTLPKTMVQFLEQGETTLSVARRALATQLPVI 91

  Fly    69 VNDDVTLLPPLTDPGKIICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKI 133
            ....||.|.|:|.|.|:||:||||.|||.|||...||.|:.||||::::|||.|.:|....|.::
Mouse    92 PRSQVTFLAPVTRPDKVICVGLNYADHCQEQNVRVPKSPIIFSKFSSSIVGPYDEIILPPESKEV 156

  Fly   134 DWEVELVCVIGKVARQVPKSQAMDYVFGYSVAQDISARDWQKERNGGQFLMGKSMDTFLPLGPAV 198
            |||||:..||||..:.:..:..|.:|.|::||.|:||||||. |||.|:|:||:.|||.|||||:
Mouse   157 DWEVEMAVVIGKKGKHIKATDVMAHVAGFTVAHDVSARDWQM-RNGKQWLLGKTFDTFCPLGPAL 220

  Fly   199 VHKSLVPDVYNLNLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVGMH 263
            |.|..:.|.:||.:...|||...|:.||..::||.:.:|..:||.:||.|||:::||||.||||.
Mouse   221 VTKDTIADPHNLKICCRVNGEVVQSSNTNQMVFKTEYLIAWVSQFVTLYPGDLLLTGTPPGVGMF 285

  Fly   264 RTPPEFLQPGDVVQSEIVGLGKLCNKIV 291
            |.||.||:.||.||.||..||.:.||:|
Mouse   286 RKPPVFLKKGDEVQCEIEELGVIINKVV 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 118/258 (46%)
FAA_hydrolase 86..290 CDD:279845 105/204 (51%)
Fahd2aNP_083905.1 MhpD 51..313 CDD:223257 118/263 (45%)
FAA_hydrolase 109..312 CDD:279845 105/204 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104996007
eggNOG 1 0.900 E1_COG0179
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I3326
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005871
OrthoInspector 1 1.000 T616284
orthoMCL 1 0.900 OOG5_126763
Panther 1 1.100 LDO PTHR42796
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5268
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.