DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6028 and SPBC21C3.09c

Sequence 1:NP_651002.3 Gene:CG6028 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_596589.1 Gene:SPBC21C3.09c PomBaseID:SPBC21C3.09c Length:221 Species:Schizosaccharomyces pombe

Alignment Length:215 Identity:72/216 (33%)
Similarity:118/216 (55%) Gaps:27/216 (13%)


  Fly    79 LTDPGKIICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGP-------QDNVIAHAASSKIDWE 136
            |:..||::|||.||..|..|.|.|.|.:|.||.|..:|:|.|       ..:|.||       :|
pombe     2 LSRAGKVVCIGRNYAAHIRELNNPFPTKPFFFLKPTSAIVEPGHGNLIIPPDVSAH-------YE 59

  Fly   137 VELVCVIG---KVARQVPKSQAMDYVFGYSVAQDISARDWQKE--RNGGQFLMGKSMDTFLPLGP 196
            |||..::.   ...|.|..:..:|.:..|.|..|::||:.|.|  :.|..:...|..|||||:||
pombe    60 VELGLIMKDRLPARRPVSSNSWLDSIGAYFVGIDMTARNIQNEAKKKGLPWSFAKGYDTFLPVGP 124

  Fly   197 AVVHKSLVPDVYNLNLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVG 261
             ::.|.|:||.:|:.|:..:||...|..:|..::.|:..:.:.:::.::|.|||:::||||||||
pombe   125 -IIPKHLIPDPHNVILELSLNGKVVQKDSTSLMLNKIPKIFSSITEAMSLNPGDLVLTGTPKGVG 188

  Fly   262 MHRTPPEFLQPGDVVQSEIV 281
            .       :.|||::.:.::
pombe   189 P-------VVPGDILSARLL 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 72/216 (33%)
FAA_hydrolase 86..290 CDD:279845 69/209 (33%)
SPBC21C3.09cNP_596589.1 MhpD <2..212 CDD:223257 72/216 (33%)
FAA_hydrolase 9..200 CDD:279845 69/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126763
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.