DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001103368.1 Gene:Qsox1 RGDID:68957 Length:750 Species:Rattus norvegicus

Alignment Length:567 Identity:181/568 (32%)
Similarity:283/568 (50%) Gaps:67/568 (12%)


  Fly     7 TLLYCLLLISP--ADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPA-LNLKNSKLVQFLNSF 68
            :||..|||:.|  ..|.|...||.|.    |||.:|.:.:||.:::||| |...::..|:|..|:
  Rat    12 SLLLLLLLLPPLLLSVPGAYAARLSV----LYSSSDPLTLLDADTVRPAVLGSSSAWAVEFFASW 72

  Fly    69 CGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDV 133
            ||.|..|||.:|.|:.|:..||..|.:..:|||.|.|:.:||||||...|::||| ....||.  
  Rat    73 CGHCIAFAPTWKELANDVKDWRPALNLAVLDCADETNSAVCREFNIAGFPTVRFF-KAFSKNG-- 134

  Fly   134 LGAVIP--GQDPEFISSTLAE-LVSQND-YGPGQPNFRPLKATDY-EIFQDQDGETPIQFVALVL 193
            .|..:|  |.:.:.:...|.: |.|..| :.|..|...|.|..|. |.|.....|    ::||:.
  Rat   135 TGTALPAAGANVQTLRMRLIDALESHRDTWPPACPPLEPAKLKDINEFFTRSKAE----YLALIF 195

  Fly   194 QPKNSKIGRDTLLELLPFKELSVRII--EDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDSS 256
            :.::|.:||:..|:|..|..::||.:  .:|.:.::|.: .|.....::.|||:...:....:|.
  Rat   196 EREDSYLGREVTLDLSQFHAVAVRRVLNSESDVVSKFAV-TDFPSCYLLLRNGSVSRVPVLVESR 259

  Fly   257 EAYASTIGDFLK-----NRNIQPD---PPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADL 313
            ..|.|    :|:     .|...|.   |..|..:||...:|.|..             ::|.|||
  Rat   260 PFYTS----YLRGLPGLTREAPPTTAAPVTPDKIAPTVWKFADRS-------------KIYMADL 307

  Fly   314 EQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLS------SKQS 372
            |.|:..:|.:|:.|:.:|||..|.|||..:.:.....|    |:.|:.:..:|::      .|:.
  Rat   308 ESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFP----GQPLVQNFLHSINDWLQKQQKKK 368

  Fly   373 IKGADFGDLVDSLENGRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEA-----AKPPNYF 432
            |..:.|...:||.:....:.:...::||.||.|..|.|.||:|.|||.|||:|     |.|....
  Rat   369 IPYSYFKAALDSRKENAVLAEKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAHRYSEAHPQEPA 433

  Fly   433 EAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTE 497
            :...:|:....:.:.||||.||:.||:||| ..::..||:....:||||.:||.||||::|..:|
  Rat   434 DGQEVLQAMRSYVQSFFGCRDCANHFEQMA-AASMHQVKSPSNAVLWLWTSHNRVNARLSGALSE 497

  Fly   498 DPKFPKIQFPSAENCPTCRSNDSE----WRTDEVLKYLKQLYDINNV 540
            ||:|||:|:|..|.|..|.:..:.    |.....|.:||..:...|:
  Rat   498 DPQFPKVQWPPRELCSACHNEVNGQVPLWDLGATLNFLKAHFSPANI 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 43/115 (37%)
Evr1_Alr 413..504 CDD:282612 42/96 (44%)
Qsox1NP_001103368.1 PDI_a_QSOX 43..155 CDD:239290 43/115 (37%)
Evr1_Alr 409..504 CDD:282612 42/96 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2390733
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 270 1.000 Inparanoid score I2872
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T131209
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.