DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and QSOX1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_172955.1 Gene:QSOX1 AraportID:AT1G15020 Length:528 Species:Arabidopsis thaliana

Alignment Length:581 Identity:136/582 (23%)
Similarity:221/582 (38%) Gaps:188/582 (32%)


  Fly     7 TLLYCLLLISPADVLGRLNARKSAN----EASLYSD--------TDNVIMLDIESLRPALNLKNS 59
            :|::..||      ||.|:...:|:    ..|:..|        .||.|.|:..:.........:
plant     2 SLIHLFLL------LGLLSLEAAASFSPGSRSILRDIGSNVADQKDNAIELNATNFDSVFQDSPA 60

  Fly    60 K--LVQFLNSFCGDCHRFAPVFKTLSRDLYK-----WRRILRIYAVDCAQERNAQLCREFNIRQT 117
            |  :::|...:|..|..:.|.::.::| |:.     :..::.:..||||.:.|.:||.:|:|...
plant    61 KYAVLEFFAHWCPACRNYKPHYEKVAR-LFNGADAVYPGVVLMTRVDCAIKMNVKLCDKFSINHY 124

  Fly   118 PSLRFFGPDMRKNDDVLGAVIPGQDPEFISSTLAELVSQNDYGPGQPNFRPLKATDYEIFQDQDG 182
            |.| |:.|..|                |:..:         :||.|                :..
plant   125 PML-FWAPPKR----------------FVGGS---------WGPKQ----------------EKN 147

  Fly   183 ETPIQFVALVLQPKNSKIGRDTLLELLPFKELSVRIIEDSQIFNEFGLGPDDQKLAIVDRNGTAQ 247
            |     :::|.:.:.:    |.||..:           :.||.:.:||  |||||          
plant   148 E-----ISVVNEWRTA----DLLLNWI-----------NKQIGSSYGL--DDQKL---------- 180

  Fly   248 YLTPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRAD 312
                            |:.|.|.:.|                 :..:|||.             |
plant   181 ----------------GNLLSNISDQ-----------------EQISQAIF-------------D 199

  Fly   313 LEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPL---------NKDGKLLLTDLDNSLS 368
            :|:|.::...|      :|...::.:.:......|:|..|         ......:|.:.|:...
plant   200 IEEATEEAFDI------ILAHKAIKSSETSASFIRFLQLLVAHHPSRRCRTGSAEILVNFDDICP 258

  Fly   369 SKQSIKGADFGDLVDSLEN----GRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPP 429
            |.:.....:.| ..|||.|    |:.|.:. .|..|.||:...|.|:|.:|.|.|.|:|......
plant   259 SGECSYDQESG-AKDSLRNFHICGKDVPRG-YYRFCRGSKNETRGFSCGLWVLMHSLSVRIEDGE 321

  Fly   430 NYFEAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEE----ILWLWAAHNEVNAR 490
            :.|...:|.    .|...||.|.||..||..|.:     ||||..::    .||||:.||:||.|
plant   322 SQFAFTAIC----DFINNFFMCDDCRRHFHDMCL-----SVKTPFKKARDIALWLWSTHNKVNER 377

  Fly   491 IAGD----STEDPKFPKIQFPSAENCPTCRSNDSE----WRTDEVLKYLKQLYDINNVSFY 543
            :..|    .|.||||||:.:|..:.||:|..:.:|    |..|:|.|:||:.|....||.|
plant   378 LKKDEDSLGTGDPKFPKMIWPPKQLCPSCYLSSTEKNIDWDHDQVYKFLKKYYGQKLVSVY 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 26/119 (22%)
Evr1_Alr 413..504 CDD:282612 37/99 (37%)
QSOX1NP_172955.1 PDI_a_QSOX 41..161 CDD:239290 32/172 (19%)
Evr1_Alr 305..394 CDD:282612 36/98 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D498515at2759
OrthoInspector 1 1.000 T32302
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.714 Consistency score
76.970

Return to query results.
Submit another query.