DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and QSOX2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_565258.1 Gene:QSOX2 AraportID:AT2G01270 Length:495 Species:Arabidopsis thaliana

Alignment Length:577 Identity:138/578 (24%)
Similarity:216/578 (37%) Gaps:183/578 (32%)


  Fly     4 LLKTLLYCLLLI-----SPADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPALNLKNSK--L 61
            |:..||:..|:|     ||.   .||..|:.:::      .|..:.|:..:....|....:|  :
plant     3 LVHLLLFAGLVIAASSSSPG---SRLILREISDQ------KDKAVELNTTNFDSVLKDTPAKYAV 58

  Fly    62 VQFLNSFCGDCHRFAPVFKTLSRDLYK-----WRRILRIYAVDCAQERNAQLCREFNIRQTPSLR 121
            |:|...:|..|..:.|.::.::| |:.     ...|:.:..||||.:.|.:||.:|::...|.| 
plant    59 VEFFAHWCPACRNYKPHYEKVAR-LFNGPDAIHPGIVLMTRVDCAMKTNTKLCDKFSVSHYPML- 121

  Fly   122 FFGPDMRKNDDVLGAVIPGQDPEFISSTLAELVSQNDYGPGQPNFRPLKATDYEIFQDQDGETPI 186
            |:||..:                |:|            |..:|     |....||....||.|  
plant   122 FWGPPTK----------------FVS------------GSWEP-----KKDKSEILVIDDGRT-- 151

  Fly   187 QFVALVLQPKNSKIGRDTLLELLPFKELSVRIIEDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTP 251
                           .:.||..:           :.||.:.:||  ||||               
plant   152 ---------------AERLLNWI-----------NKQIGSSYGL--DDQK--------------- 173

  Fly   252 SSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLEQA 316
                           .||.:          ...|.|:: :..:||:.             |:|:|
plant   174 ---------------FKNEH----------ALSNLTDY-NQISQAVY-------------DVEEA 199

  Fly   317 IDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPL---------NKDGKLLLTDLDNSLSSKQS 372
            ..:...|      :|...::.:.:......|::..|         .|....:|.:.|:...|...
plant   200 TAEAFDI------ILAHKAIKSSETSASFIRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNC 258

  Fly   373 IKGADFGDLVDSLEN----GRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPNYFE 433
            ......|:  |:|.|    |:.|.:. .|:.|.||:...|.|:|.:|.|.|.|:|......::| 
plant   259 SYEKSGGN--DTLGNFPICGKDVPRG-YYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHF- 319

  Fly   434 AGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEE----ILWLWAAHNEVNARIAGD 494
               ...|...|...||.|.:|..||..|.:     ||||..::    :||:|:.||:||.|:..|
plant   320 ---AFTTICDFVNNFFMCDECRLHFNDMCL-----SVKTPFKKARDFVLWVWSTHNKVNERLLKD 376

  Fly   495 ----STEDPKFPKIQFPSAENCPTC--RSNDS--EWRTDEVLKYLKQLYDINNVSFY 543
                .|.|||||||.:|..|.||.|  .||..  ||..:.|.|:||..|....||.|
plant   377 EASLGTGDPKFPKIIWPPKELCPLCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLY 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 27/119 (23%)
Evr1_Alr 413..504 CDD:282612 35/99 (35%)
QSOX2NP_565258.1 Thioredoxin_like 35..155 CDD:294274 35/172 (20%)
Evr1_Alr 300..390 CDD:282612 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D498515at2759
OrthoInspector 1 1.000 T32302
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.