DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001102904.1 Gene:Qsox2 RGDID:1584720 Length:708 Species:Rattus norvegicus

Alignment Length:556 Identity:169/557 (30%)
Similarity:273/557 (49%) Gaps:51/557 (9%)


  Fly    12 LLLISPADVLGRLNARKSANEASLYS-DTDNVIMLDIESLRPAL-NLKNSKLVQFLNSFCGDCHR 74
            |||::....:|    .:....|.||. ..|.|.:||..|:|.|. |...:.||||.:|:||.|..
  Rat    46 LLLLAVVAAVG----PQEGGGARLYRVGEDAVWLLDSGSVRSATGNSSAAWLVQFHSSWCGHCIG 106

  Fly    75 FAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGAVIP 139
            :||.::.|:.|:..|...:|:.|:|||:|:|..:||.::|...|:.|:|....:  :...|....
  Rat   107 YAPTWRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFRAFTK--EFTTGENFK 169

  Fly   140 GQDPEF--ISSTLAELVSQNDYG---PGQPNFRPLKATDYEIFQDQDGETPIQFVALVLQPKNSK 199
            |.|.|.  :..|:.:.:..:..|   |..|...|::::|...|.|....   |:.|:|.:...|.
  Rat   170 GPDRELRTVRQTMIDFLQNHTEGSRPPACPPLDPIQSSDILSFMDSHSG---QYHAVVFESNGSY 231

  Fly   200 IGRDTLLELLPFKELSV-RIIE-DSQIFNEFGLG--PDDQKLAIVDRNGTAQYLTPSSDSSEAYA 260
            :||:.:|:|:|:..:.| |.:: |.......|:.  |....:.....:|......|......:|.
  Rat   232 VGREVILDLIPYDNIMVSRALDTDKAFLGTLGISSVPSCYLIYPNGSHGLVNVAKPLRSFFSSYL 296

  Fly   261 STIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLEQAIDKLLHIEL 325
            .::.|..|.....|:.|..           :..::.::.|.. ...::|.||||..:..||.:||
  Rat   297 KSLPDVRKKSLSLPEKPNK-----------EENSEVVIWKEF-DRAKLYTADLESGLHYLLRVEL 349

  Fly   326 RKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQSIKGADFGDLVDSLENGRR 390
            .....|.|..|...|:.:.:...|.|.....|.||..|...|::....| ..:..::|.:.|..:
  Rat   350 AAHRSLAGAQLKTFKDFVTVIAKLFPGRPPVKKLLETLHEWLANLPLDK-IPYNAILDLVNNKMQ 413

  Fly   391 V---FKARR--YVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPNY-----FEAG--SILKTFHG 443
            :   |....  :|||.|||..||.:.||:|.|||.|||:|:..|..     ||..  ::|:|...
  Rat   414 ISGLFLTSHITWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALVGTGFEGDPQAVLQTMRR 478

  Fly   444 FAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPS 508
            :.:.||||.:|.|||::|| :.::.||||.|:.:||||..||.||:|:||..:|||||||:.:|:
  Rat   479 YIRTFFGCKECGEHFEEMA-KESMDSVKTADQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPT 542

  Fly   509 AENCPTCRSN----DSEWRTDEVLKYLKQLYDINNV 540
            .:.||.|...    || |..::||.:|||.|..:|:
  Rat   543 PDLCPVCHEEIKGLDS-WDEEQVLVFLKQHYSRDNL 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 39/115 (34%)
Evr1_Alr 413..504 CDD:282612 47/98 (48%)
Qsox2NP_001102904.1 PDI_a_QSOX 71..184 CDD:239290 39/117 (33%)
Evr1_Alr 441..538 CDD:282612 50/104 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2484281
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 1 1.000 H65608
Inparanoid 1 1.050 270 1.000 Inparanoid score I2872
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T131209
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.