DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and qsox1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_002937004.1 Gene:qsox1 XenbaseID:XB-GENE-944881 Length:741 Species:Xenopus tropicalis

Alignment Length:540 Identity:161/541 (30%)
Similarity:265/541 (49%) Gaps:63/541 (12%)


  Fly    31 NEASLYSDTDNVIMLDIESLRPALNLKNSKLVQFLNSFCGDCHRFAPVFKTLSRDLYKWRRILRI 95
            :.|.||:..:.|:.||.::....|..::..:.:|..|:||.|.||.|.:..|:.|:..||.::.:
 Frog    22 SHAGLYTPDEPVVHLDRKAHTYLLGSRSFWVAEFYASWCGHCQRFKPSWSGLAEDIKDWRPVVYL 86

  Fly    96 YAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRK-----NDDVLGAVIPGQDPEFISSTLAELVS 155
            ..:|||:..|.:.|.||.:...|:::.|....::     ::|.:.:|     .....:.:..|..
 Frog    87 GVIDCAESSNFETCNEFGVEGYPTIKSFKSFTKEVSQGVSEDAVHSV-----QALRENIITRLEE 146

  Fly   156 QNDYGPGQ-PNFRPLKATDYEIFQDQDGETPIQFVALVLQPKNSKIGRDTLLELLPFKELSVRII 219
            |.|..|.. |...|:...:.|.|.....|   .::||:.:..:..|||:|.|:::.::.:|||.:
 Frog   147 QKDSRPSSWPPLEPISTFEVENFFKTKQE---NYLALIFEEPSMYIGRETTLDMVQYEGVSVRRV 208

  Fly   220 --EDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDSSEAYASTIGDFLKNRNIQPDPPLP--- 279
              :.:.:.|:|.: .....|.::.|||:...:...:|:..:|.    |||::        ||   
 Frog   209 LRDQNDMVNKFWI-TSYPSLVLLSRNGSNTVVNLKADTRSSYT----DFLRS--------LPGVR 260

  Fly   280 ------IAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLEQAIDKLLHIELRKWVLLEGNSLNA 338
                  |.||.|.|...|.:..|..||       :|.||||.|:...|..|:.::..|||..|:|
 Frog   261 KKNLFIIGVANNGTTEQDDRRIADSTK-------LYMADLESAVHYTLRAEVSRFSHLEGERLDA 318

  Fly   339 LKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSK--QSIKGADFGDLVDSLENGRR--VFKARRYVG 399
            |...:.:.|...|....|..||..:.:.|..:  :.:...||.:::::.:..:.  :..:..||.
 Frog   319 LIAYVSVLRKYFPARPYGTTLLKSIHSWLHDRAGKEVLYKDFENVLNNKDEAQNAVLSSSVNYVW 383

  Fly   400 CIGSRPLLRSFTCSMWTLFHHLTVEA----AKPPNYFEAGSILKTFHGFAKYFFGCTDCSEHFQQ 460
            |.||.|..|.|.||:|||||.|||:|    |.||.     .:|....|:.|.||||.:|:.||:.
 Frog   384 CQGSHPNFRGFPCSLWTLFHFLTVQASEDTAAPPT-----EVLLGLRGYVKNFFGCRECAGHFES 443

  Fly   461 MAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTCRSNDS----E 521
            || ..::.:|.|.||.|||||..||.||.|:||..:|||:|||:.:||...||.|:..|.    .
 Frog   444 MA-AESMNTVNTLDEAILWLWDRHNRVNKRLAGQPSEDPEFPKLPWPSKTLCPFCQVEDGGDELA 507

  Fly   522 WRTDEVLKYLKQLYDINNVS 541
            |....||.::|..|...|::
 Frog   508 WDIPNVLNFMKTHYSRQNLA 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 27/117 (23%)
Evr1_Alr 413..504 CDD:282612 47/95 (49%)
qsox1XP_002937004.1 PDI_a_QSOX 31..142 CDD:239290 27/116 (23%)
Evr1_Alr 397..485 CDD:282612 46/94 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2382537
eggNOG 1 0.900 E1_KOG1731
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.