DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and QSOX1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_002817.2 Gene:QSOX1 HGNCID:9756 Length:747 Species:Homo sapiens

Alignment Length:572 Identity:176/573 (31%)
Similarity:286/573 (50%) Gaps:81/573 (14%)


  Fly     5 LKTLLYCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPA-LNLKNSKLVQFLNSF 68
            |..||..||.:..|:         :|..::|||.:|.:.:|..:::|.| |..:::..|:|..|:
Human    14 LLLLLLWLLAVPGAN---------AAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASW 69

  Fly    69 CGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDV 133
            ||.|..|||.:|.|:.|:..||..|.:.|:|||:|.|:.:||:|||...|::||| ....||.. 
Human    70 CGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFF-KAFTKNGS- 132

  Fly   134 LGAVIP--GQDPEFISSTLAE-LVSQND-YGPGQPNFRPLKATDYEIFQDQDGETPIQFVALVLQ 194
             |||.|  |.|.:.:...|.: |.|.:| :.|..|...|.|..:.:.|..::.|   :::||:.:
Human   133 -GAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNE---EYLALIFE 193

  Fly   195 PKNSKIGRDTLLELLPFKELSVRII--EDSQIFNEFGLGPDDQKLAIVDRNG------------- 244
            ...|.:||:..|:|...|.::||.:  .::.:..:||: .|.....::.|||             
Human   194 KGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGV-TDFPSCYLLFRNGSVSRVPVLMESRS 257

  Fly   245 --TAQYLTPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQ 307
              ||.....|..:.||..:|:.....|:           :||...:..|..             :
Human   258 FYTAYLQRLSGLTREAAQTTVAPTTANK-----------IAPTVWKLADRS-------------K 298

  Fly   308 VYRADLEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLS---- 368
            :|.||||.|:..:|.||:.::.:|||..|.|||..:.:.....|    |:.|:.:..:|::    
Human   299 IYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFP----GRPLVQNFLHSVNEWLK 359

  Fly   369 --SKQSIKGADFGDLVDSLENGRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAK---- 427
              .:..|..:.|...:|..:.|..:.|...::||.||.|..|.|.||:|.|||.|||:||:    
Human   360 RQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVD 424

  Fly   428 -PPNYFEAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARI 491
             .....:|..:|....|:..|||||.||:.||:||| ..::..|.:.:..:||||::||.||||:
Human   425 HSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMA-AASMHRVGSPNAAVLWLWSSHNRVNARL 488

  Fly   492 AGDSTEDPKFPKIQFPSAENCPTCRSNDSE---WRTDEVLKYLKQLYDINNV 540
            ||..:|||:|||:|:|..|.|..|.:...:   |..:..|.:||..:..:|:
Human   489 AGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNI 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 44/115 (38%)
Evr1_Alr 413..504 CDD:282612 44/96 (46%)
QSOX1NP_002817.2 PDI_a_QSOX 40..152 CDD:239290 44/115 (38%)
Evr1_Alr 406..501 CDD:282612 44/96 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2389635
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I3024
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T130188
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.