DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and qsox2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_009300239.1 Gene:qsox2 ZFINID:ZDB-GENE-110203-4 Length:656 Species:Danio rerio

Alignment Length:576 Identity:182/577 (32%)
Similarity:287/577 (50%) Gaps:84/577 (15%)


  Fly    10 YCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESLR-PALNLKNSKLVQFLNSFCGDCH 73
            :||.:   :.::|.|..|  |..|.||::.|.|::|..:||: ..||..::.||||.:|:||.|.
Zfish     5 FCLKI---SIIVGLLFGR--AQPARLYTEEDPVVILSSDSLKQTVLNSSSAWLVQFYSSWCGHCI 64

  Fly    74 RFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGAVI 138
            :::|.:|.|:.|:..|.:.:||..||||.|:|..:|:||.|...|:.|:|......||  .|...
Zfish    65 QYSPTWKALAGDVKDWAQAIRIGVVDCAHEKNFDICKEFGIHFYPTFRYFKAHDTTND--FGKTY 127

  Fly   139 PGQDPEFISSTLAELV-------SQNDYGPGQPNFRPLKATDYEIFQDQDGETPIQFVALVLQPK 196
            .|.|.|.  .|:.:|:       ::.|:..|.|...|.::.|.....   |:....:.|::::..
Zfish   128 QGADREL--QTVRQLMVNFIQNHTRQDWPVGCPPLHPARSEDVLSLM---GKKTEHYTAVIVEDG 187

  Fly   197 NSKIGRDTLLELLPFKELSVR--IIEDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDSSEAY 259
            ||.|||:.:|:|:|::.|.|:  :..|..:.::.|:. ......:...|||...|.........:
Zfish   188 NSYIGREVILDLMPYEGLVVKRALSSDQLLMDKLGIS-SVPSAYLFQPNGTHTVLNVQKKLRFFF 251

  Fly   260 ASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPP------------------L 306
            :|    |||             :.|..     |:.|:  |..|..|                  .
Zfish   252 SS----FLK-------------LLPGV-----HRKQS--TSSLQRPQPGINGQGAQVEWKEFKKS 292

  Fly   307 QVYRADLEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKD-GKLLLTDLDNSLSSK 370
            :||.||||..:..||.:||.....|||..|...|:.:.:...|.|.::. .|||.|.|:..:|  
Zfish   293 KVYMADLESGLHYLLRVELATHKTLEGEELKTFKDFVTVVAKLFPGHQSVVKLLETLLEWLVS-- 355

  Fly   371 QSIKGADFGDLVDSLENGRRV-----FKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPN 430
            ..::...:..::|.:.|..|:     .:..::|||.||...||.:.||:|||||.|||:||..|:
Zfish   356 LPLEKIPYDAILDLVNNKMRISGLYLSEQVQWVGCQGSSVALRGYPCSLWTLFHVLTVQAANRPD 420

  Fly   431 Y-----FEAG--SILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVN 488
            .     ||..  ::|:|...:...||||.:|.:||::|| :.:|..|||.||.:||||..||:||
Zfish   421 ALANTGFEDDPLAVLQTMRRYIGTFFGCQECGKHFEEMA-QESLNQVKTVDEAVLWLWRKHNQVN 484

  Fly   489 ARIAGDSTEDPKFPKIQFPSAENCPTCRSNDS---EWRTDEVLKYLKQLYDINNVS 541
            ||::|..:|||.|||.|:|:.:.||||.....   .|....||.:|||.|..:|:|
Zfish   485 ARLSGSMSEDPMFPKTQWPTPDLCPTCHEEQEGLHVWNEQMVLAFLKQHYSASNIS 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 42/113 (37%)
Evr1_Alr 413..504 CDD:282612 48/98 (49%)
qsox2XP_009300239.1 PDI_a_QSOX 30..141 CDD:239290 43/115 (37%)
Evr1_Alr 403..499 CDD:282612 47/97 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2435129
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 1 1.000 H65608
Inparanoid 1 1.050 272 1.000 Inparanoid score I2901
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T128705
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.