DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox3

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_650997.1 Gene:Qsox3 FlyBaseID:FBgn0038918 Length:562 Species:Drosophila melanogaster

Alignment Length:553 Identity:221/554 (40%)
Similarity:333/554 (60%) Gaps:42/554 (8%)


  Fly     9 LYCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESLR-----PALNLKNSKLVQFLNSF 68
            |.|::||..... |....|....|..|||..||:.::...||:     ||:    .||||||||:
  Fly    10 LTCIILILIVQE-GHSKQRCLDEEPPLYSKEDNIHVVVGASLKKILAEPAM----GKLVQFLNSY 69

  Fly    69 CGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDV 133
            ||:|.|||..|:.::.||.||.|:|||||||||:..|.:|||:|.|..||::|::....::....
  Fly    70 CGNCRRFAHTFRKMAVDLQKWNRVLRIYAVDCARLENVKLCRDFRITLTPTIRYYPSKFQRIRHG 134

  Fly   134 LGAVIPGQDPEFISSTLAELVSQNDYGPG---QPNFRPL----KATD-YEIFQDQDGETPIQFVA 190
            :|..|....|..|:..|.|.:|:|||...   :|.|.|:    |..| ||.|.::     :.::.
  Fly   135 IGTDIETTIPSEIADQLIESLSENDYSESKGVKPIFDPIEPGNKLNDIYEQFDNK-----VTYIL 194

  Fly   191 LVLQPKNSKIGRDTLLELLPFKELSVRIIEDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDS 255
            || .|.:  :|.:|:|.:||:.::.||||:|:::|.:|||.|..|.:|:::|:|.||.:.|:..|
  Fly   195 LV-HPVD--MGIETILNMLPYPDVGVRIIKDAEMFAQFGLKPCKQMVALLNRSGKAQLIKPAGKS 256

  Fly   256 SEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFL--DHQNQAILTKVLTPPLQVYRADLEQAID 318
            |.||..::...|........|.||    |...|::  :..:..|:..||.....:::|||||||.
  Fly   257 SSAYVESVAGLLHQNGHTSMPTLP----PAEPEYILSEGYDAFIVDYVLNSTKVLFQADLEQAIY 317

  Fly   319 KLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQSIKGADFGDLVD 383
            :.||:|:.|...:.|....||::||::||..|.||:||:.:|..|.|.|.....|.|.:|.|:||
  Fly   318 QFLHVEIPKTAFISGFKFKALRHIIRLFRRFNVLNRDGRRMLNSLVNHLFEVTEITGEEFRDVVD 382

  Fly   384 SLENG-RRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAK----PPNYFEAGSILKTFHG 443
            .|:.. ..:|..::||||:||.|..|.|:||:|||||:.||.||:    ||:     |:....:|
  Fly   383 DLQTRLDPIFAEQQYVGCLGSTPHTRRFSCSLWTLFHYFTVLAAQMKVYPPS-----SVTIGLYG 442

  Fly   444 FAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPS 508
            .||:|:.|.|.|.:|.::|.|.|:..|:||||||||||.||||||.::|||::.||:|||:|||.
  Fly   443 LAKFFYDCKDGSMYFVKLAKRMNIAKVRTHDEEILWLWEAHNEVNEKLAGDASGDPRFPKVQFPE 507

  Fly   509 AENCPTCRSNDSEWRTDEVLKYLKQLYDINNVS 541
            .::||.|.::..|:..||||||||::|:::.:|
  Fly   508 RKHCPDCYTHSGEFDRDEVLKYLKRVYNLSYLS 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 49/117 (42%)
Evr1_Alr 413..504 CDD:282612 49/95 (52%)
Qsox3NP_650997.1 PDI_a_QSOX 40..153 CDD:239290 49/117 (42%)
Evr1_Alr 413..503 CDD:282612 49/95 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131143078
eggNOG 1 0.900 E1_KOG1731
Homologene 1 1.000 H65608
Inparanoid 1 1.050 163 1.000 Inparanoid score I1564
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 P PTHR22897
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.