DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001286383.1 Gene:Qsox1 FlyBaseID:FBgn0033814 Length:637 Species:Drosophila melanogaster

Alignment Length:542 Identity:195/543 (36%)
Similarity:293/543 (54%) Gaps:46/543 (8%)


  Fly    35 LYSDTDNVIMLDIESLR-PALNLKNSKLVQFLNSFCGDCHRFAPVFKTLSRDLYKWRRILRIYAV 98
            ||.|.|.||.|.:::.. ..|:.....||:|.|::||.|.||||.:|:::..|..|..:|.:.|:
  Fly    44 LYDDGDKVIRLSVDNFNATVLDQNRGALVEFYNTYCGHCRRFAPTYKSVAEHLLPWSEVLIVAAI 108

  Fly    99 DCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGAVIPGQDPEFISSTLAELVS-------- 155
            |||.|.|..:||.:.:...|:||:.||..:......|..:..||...|...||.:|:        
  Fly   109 DCAAEENNGICRNYEVMGYPTLRYLGPGFQPGPQHYGQSLHTQDKNEIREILAGMVAAENLTSSH 173

  Fly   156 QNDYGPGQPNFRPLKATD--YEIFQDQDGETPIQFVALVLQPKNSKIGRDTLLELLPFKELSVRI 218
            .|.|   .|||..|...|  ..:|:.....|  ::||:|.:|:|:.:|.:..|.:..:..:.||.
  Fly   174 NNSY---WPNFHYLTENDSASSLFEGLSSAT--EYVAVVHEPENTTLGVEVALFMTQWPAVRVRR 233

  Fly   219 IEDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDSSEAYASTIGDFLKNRNIQPDP------- 276
            :.|..:..:|.:.|.:..|::|||.|......|.|.:.|:||..:.|.|..:||.|.|       
  Fly   234 VIDPAVAAKFKIDPTNLPLSLVDRKGEITAYAPESTNGESYAKKLWDVLGKKNITPRPVKVHQPS 298

  Fly   277 PLPIAVAPNFTEFLD--HQNQAILTKVLTPPLQVYRADLEQAIDKLLHIELRKWVLLEGNSLNAL 339
            ..|.:......|.:|  |:|:..          ||:|||||||..:||.|:.|...:.|..|.||
  Fly   299 ATPASKIKGQNELIDEVHRNKHF----------VYQADLEQAIRTVLHNEVSKVGEISGEKLLAL 353

  Fly   340 KNIIKIFRYLNPLNKDGKLLLTDLDNSL--SSKQSIKGADFGDLVDSLE-NGRRVFKARRYVGCI 401
            :..:.:.:..|||..:|..|::.|.:.:  .:.|.:.|:.|.:.:..|| :...|:.:..:|||:
  Fly   354 QRFLAVLQRYNPLGANGHQLVSKLKDYVVQFNDQRLTGSQFEEELKRLEAHLSPVYSSNHFVGCV 418

  Fly   402 GSRPLLRSFTCSMWTLFHHLTVEAAKPPNYFEAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRN 466
            ||.|.||.|:||:|||||.:||:||......:...:|:..||:.|.|||||:||||||.||.||.
  Fly   419 GSSPRLRGFSCSLWTLFHFMTVQAANNEETQDPLEVLQAMHGYIKNFFGCTECSEHFQAMASRRK 483

  Fly   467 LTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTC--------RSNDSEWR 523
            :.||...:|.:|||||||||||.|:|||:||||:|||.|||:.|:|..|        .:.:.||.
  Fly   484 IWSVPNKEEAVLWLWAAHNEVNQRLAGDATEDPEFPKKQFPAPESCNECYRTPVSKSENLEIEWN 548

  Fly   524 TDEVLKYLKQLYDINNVSFYGL 545
            .|.||.:||.:::...||.||:
  Fly   549 KDAVLGFLKNIHNPQFVSRYGV 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 39/113 (35%)
Evr1_Alr 413..504 CDD:282612 54/91 (59%)
Qsox1NP_001286383.1 PDI_a_QSOX 49..162 CDD:239290 39/113 (35%)
Evr1_Alr 430..521 CDD:282612 54/91 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131143152
eggNOG 1 0.900 E1_KOG1731
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1564
Isobase 1 0.950 0 Normalized mean entropy S4773
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 P PTHR22897
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
98.870

Return to query results.
Submit another query.